Technetium 99m–Labeled VQ Peptide: A New Imaging Agent for the Early Detection of Tumors or Premalignancies
There is a critical need to develop diagnostic procedures enabling early detection of tumors while at a curable stage. Technetium 99m ( 99m Tc)-labeled VQ peptide ( 99m Tc-HYNIC-VQ) identified through screening phage display peptide libraries against fresh human colonic adenomas was prepared and eva...
Saved in:
| Main Authors: | , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
SAGE Publishing
2013-07-01
|
| Series: | Molecular Imaging |
| Online Access: | https://doi.org/10.2310/7290.2012.00047 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1841563115285643264 |
|---|---|
| author | Jiyun Shi Liyang Cui Bing Jia Zhaofei Liu Peng He Chengyan Dong Xiaona Jin Huiyun Zhao Fang Li Fan Wang |
| author_facet | Jiyun Shi Liyang Cui Bing Jia Zhaofei Liu Peng He Chengyan Dong Xiaona Jin Huiyun Zhao Fang Li Fan Wang |
| author_sort | Jiyun Shi |
| collection | DOAJ |
| description | There is a critical need to develop diagnostic procedures enabling early detection of tumors while at a curable stage. Technetium 99m ( 99m Tc)-labeled VQ peptide ( 99m Tc-HYNIC-VQ) identified through screening phage display peptide libraries against fresh human colonic adenomas was prepared and evaluated for tumor detection. 99m Tc-HYNIC-VQ was prepared by a non-SnCl 2 method with more than 99% radiochemical purity. The biodistribution in the HT-29 tumor model showed that although the absolute tumor uptake values were relatively low (0.60 ± 0.09, 0.41 ± 0.09, 0.36 ± 0.18, and 0.19 ± 0.08 %ID/g at 0.5, 1, 2, and 4 hours postinjection, respectively), the tumor uptake was higher than that of any of the other organs except for the kidneys at any time point examined, which led to the high tumor to nontarget ratios. The tumors and inflammation were clearly visualized with high contrast. Although the mechanism of accumulation of radiolabeled VQ peptide in tumors and inflammation needs to be further investigated, 99m Tc-HYNIC-VQ is a promising imaging agent for the early detection of tumors or premalignancies, at least for screening patients with a high risk of developing cancers. |
| format | Article |
| id | doaj-art-f135027d62c14091a0180537da77cf6b |
| institution | Kabale University |
| issn | 1536-0121 |
| language | English |
| publishDate | 2013-07-01 |
| publisher | SAGE Publishing |
| record_format | Article |
| series | Molecular Imaging |
| spelling | doaj-art-f135027d62c14091a0180537da77cf6b2025-01-03T00:12:13ZengSAGE PublishingMolecular Imaging1536-01212013-07-011210.2310/7290.2012.0004710.2310_7290.2012.00047Technetium 99m–Labeled VQ Peptide: A New Imaging Agent for the Early Detection of Tumors or PremalignanciesJiyun ShiLiyang CuiBing JiaZhaofei LiuPeng HeChengyan DongXiaona JinHuiyun ZhaoFang LiFan WangThere is a critical need to develop diagnostic procedures enabling early detection of tumors while at a curable stage. Technetium 99m ( 99m Tc)-labeled VQ peptide ( 99m Tc-HYNIC-VQ) identified through screening phage display peptide libraries against fresh human colonic adenomas was prepared and evaluated for tumor detection. 99m Tc-HYNIC-VQ was prepared by a non-SnCl 2 method with more than 99% radiochemical purity. The biodistribution in the HT-29 tumor model showed that although the absolute tumor uptake values were relatively low (0.60 ± 0.09, 0.41 ± 0.09, 0.36 ± 0.18, and 0.19 ± 0.08 %ID/g at 0.5, 1, 2, and 4 hours postinjection, respectively), the tumor uptake was higher than that of any of the other organs except for the kidneys at any time point examined, which led to the high tumor to nontarget ratios. The tumors and inflammation were clearly visualized with high contrast. Although the mechanism of accumulation of radiolabeled VQ peptide in tumors and inflammation needs to be further investigated, 99m Tc-HYNIC-VQ is a promising imaging agent for the early detection of tumors or premalignancies, at least for screening patients with a high risk of developing cancers.https://doi.org/10.2310/7290.2012.00047 |
| spellingShingle | Jiyun Shi Liyang Cui Bing Jia Zhaofei Liu Peng He Chengyan Dong Xiaona Jin Huiyun Zhao Fang Li Fan Wang Technetium 99m–Labeled VQ Peptide: A New Imaging Agent for the Early Detection of Tumors or Premalignancies Molecular Imaging |
| title | Technetium 99m–Labeled VQ Peptide: A New Imaging Agent for the Early Detection of Tumors or Premalignancies |
| title_full | Technetium 99m–Labeled VQ Peptide: A New Imaging Agent for the Early Detection of Tumors or Premalignancies |
| title_fullStr | Technetium 99m–Labeled VQ Peptide: A New Imaging Agent for the Early Detection of Tumors or Premalignancies |
| title_full_unstemmed | Technetium 99m–Labeled VQ Peptide: A New Imaging Agent for the Early Detection of Tumors or Premalignancies |
| title_short | Technetium 99m–Labeled VQ Peptide: A New Imaging Agent for the Early Detection of Tumors or Premalignancies |
| title_sort | technetium 99m labeled vq peptide a new imaging agent for the early detection of tumors or premalignancies |
| url | https://doi.org/10.2310/7290.2012.00047 |
| work_keys_str_mv | AT jiyunshi technetium99mlabeledvqpeptideanewimagingagentfortheearlydetectionoftumorsorpremalignancies AT liyangcui technetium99mlabeledvqpeptideanewimagingagentfortheearlydetectionoftumorsorpremalignancies AT bingjia technetium99mlabeledvqpeptideanewimagingagentfortheearlydetectionoftumorsorpremalignancies AT zhaofeiliu technetium99mlabeledvqpeptideanewimagingagentfortheearlydetectionoftumorsorpremalignancies AT penghe technetium99mlabeledvqpeptideanewimagingagentfortheearlydetectionoftumorsorpremalignancies AT chengyandong technetium99mlabeledvqpeptideanewimagingagentfortheearlydetectionoftumorsorpremalignancies AT xiaonajin technetium99mlabeledvqpeptideanewimagingagentfortheearlydetectionoftumorsorpremalignancies AT huiyunzhao technetium99mlabeledvqpeptideanewimagingagentfortheearlydetectionoftumorsorpremalignancies AT fangli technetium99mlabeledvqpeptideanewimagingagentfortheearlydetectionoftumorsorpremalignancies AT fanwang technetium99mlabeledvqpeptideanewimagingagentfortheearlydetectionoftumorsorpremalignancies |