Pasteurized waste milk vs. milk replacer at the same crude protein:metabolizable energy ratio with different energy sources (fat vs. lactose) to pre-weaning Holstein calves: Effects on growth performance, feeding behavior, and health
Saved in:
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Public Library of Science (PLoS)
2025-01-01
|
| Series: | PLoS ONE |
| Online Access: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC11737732/?tool=EBI |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832592752381001728 |
|---|---|
| author | Shahryar Kargar Borhan Moradi Meysam Kanani Marzia Albenzio Mariangela Caroprese Mohammad Javad Zamiri Ícaro Rainyer Rodrigues de Castro Marcos Inácio Marcondes |
| author_facet | Shahryar Kargar Borhan Moradi Meysam Kanani Marzia Albenzio Mariangela Caroprese Mohammad Javad Zamiri Ícaro Rainyer Rodrigues de Castro Marcos Inácio Marcondes |
| author_sort | Shahryar Kargar |
| collection | DOAJ |
| format | Article |
| id | doaj-art-e22e113484554b78959a10bcb767a377 |
| institution | Kabale University |
| issn | 1932-6203 |
| language | English |
| publishDate | 2025-01-01 |
| publisher | Public Library of Science (PLoS) |
| record_format | Article |
| series | PLoS ONE |
| spelling | doaj-art-e22e113484554b78959a10bcb767a3772025-01-21T05:31:37ZengPublic Library of Science (PLoS)PLoS ONE1932-62032025-01-01201Pasteurized waste milk vs. milk replacer at the same crude protein:metabolizable energy ratio with different energy sources (fat vs. lactose) to pre-weaning Holstein calves: Effects on growth performance, feeding behavior, and healthShahryar KargarBorhan MoradiMeysam KananiMarzia AlbenzioMariangela CaropreseMohammad Javad ZamiriÍcaro Rainyer Rodrigues de CastroMarcos Inácio Marcondeshttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC11737732/?tool=EBI |
| spellingShingle | Shahryar Kargar Borhan Moradi Meysam Kanani Marzia Albenzio Mariangela Caroprese Mohammad Javad Zamiri Ícaro Rainyer Rodrigues de Castro Marcos Inácio Marcondes Pasteurized waste milk vs. milk replacer at the same crude protein:metabolizable energy ratio with different energy sources (fat vs. lactose) to pre-weaning Holstein calves: Effects on growth performance, feeding behavior, and health PLoS ONE |
| title | Pasteurized waste milk vs. milk replacer at the same crude protein:metabolizable energy ratio with different energy sources (fat vs. lactose) to pre-weaning Holstein calves: Effects on growth performance, feeding behavior, and health |
| title_full | Pasteurized waste milk vs. milk replacer at the same crude protein:metabolizable energy ratio with different energy sources (fat vs. lactose) to pre-weaning Holstein calves: Effects on growth performance, feeding behavior, and health |
| title_fullStr | Pasteurized waste milk vs. milk replacer at the same crude protein:metabolizable energy ratio with different energy sources (fat vs. lactose) to pre-weaning Holstein calves: Effects on growth performance, feeding behavior, and health |
| title_full_unstemmed | Pasteurized waste milk vs. milk replacer at the same crude protein:metabolizable energy ratio with different energy sources (fat vs. lactose) to pre-weaning Holstein calves: Effects on growth performance, feeding behavior, and health |
| title_short | Pasteurized waste milk vs. milk replacer at the same crude protein:metabolizable energy ratio with different energy sources (fat vs. lactose) to pre-weaning Holstein calves: Effects on growth performance, feeding behavior, and health |
| title_sort | pasteurized waste milk vs milk replacer at the same crude protein metabolizable energy ratio with different energy sources fat vs lactose to pre weaning holstein calves effects on growth performance feeding behavior and health |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC11737732/?tool=EBI |
| work_keys_str_mv | AT shahryarkargar pasteurizedwastemilkvsmilkreplaceratthesamecrudeproteinmetabolizableenergyratiowithdifferentenergysourcesfatvslactosetopreweaningholsteincalveseffectsongrowthperformancefeedingbehaviorandhealth AT borhanmoradi pasteurizedwastemilkvsmilkreplaceratthesamecrudeproteinmetabolizableenergyratiowithdifferentenergysourcesfatvslactosetopreweaningholsteincalveseffectsongrowthperformancefeedingbehaviorandhealth AT meysamkanani pasteurizedwastemilkvsmilkreplaceratthesamecrudeproteinmetabolizableenergyratiowithdifferentenergysourcesfatvslactosetopreweaningholsteincalveseffectsongrowthperformancefeedingbehaviorandhealth AT marziaalbenzio pasteurizedwastemilkvsmilkreplaceratthesamecrudeproteinmetabolizableenergyratiowithdifferentenergysourcesfatvslactosetopreweaningholsteincalveseffectsongrowthperformancefeedingbehaviorandhealth AT mariangelacaroprese pasteurizedwastemilkvsmilkreplaceratthesamecrudeproteinmetabolizableenergyratiowithdifferentenergysourcesfatvslactosetopreweaningholsteincalveseffectsongrowthperformancefeedingbehaviorandhealth AT mohammadjavadzamiri pasteurizedwastemilkvsmilkreplaceratthesamecrudeproteinmetabolizableenergyratiowithdifferentenergysourcesfatvslactosetopreweaningholsteincalveseffectsongrowthperformancefeedingbehaviorandhealth AT icarorainyerrodriguesdecastro pasteurizedwastemilkvsmilkreplaceratthesamecrudeproteinmetabolizableenergyratiowithdifferentenergysourcesfatvslactosetopreweaningholsteincalveseffectsongrowthperformancefeedingbehaviorandhealth AT marcosinaciomarcondes pasteurizedwastemilkvsmilkreplaceratthesamecrudeproteinmetabolizableenergyratiowithdifferentenergysourcesfatvslactosetopreweaningholsteincalveseffectsongrowthperformancefeedingbehaviorandhealth |