Silibinin protects the ischemic brain in mice by exerting anti-apoptotic effects via the EGFR/ERK pathway

Apoptosis is a significant occurrence of cell death in the cerebral ischemia process, potentially revealing specific treatment points. Silibinin (SIL) has been proven to regulate a range of biological effects on inflammation, oxidative stress and apoptosis. Meanwhile, the epidermal growth factor rec...

Full description

Saved in:
Bibliographic Details
Main Authors: Linlin Li, Wenyan Shang, Yuexia Ma, Cong Zhang, Xiangjian Zhang
Format: Article
Language:English
Published: Elsevier 2025-06-01
Series:Brain Research Bulletin
Subjects:
Online Access:http://www.sciencedirect.com/science/article/pii/S0361923025001650
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1849327815721222144
author Linlin Li
Wenyan Shang
Yuexia Ma
Cong Zhang
Xiangjian Zhang
author_facet Linlin Li
Wenyan Shang
Yuexia Ma
Cong Zhang
Xiangjian Zhang
author_sort Linlin Li
collection DOAJ
description Apoptosis is a significant occurrence of cell death in the cerebral ischemia process, potentially revealing specific treatment points. Silibinin (SIL) has been proven to regulate a range of biological effects on inflammation, oxidative stress and apoptosis. Meanwhile, the epidermal growth factor receptor (EGFR) has been reported to impact cell apoptosis owing to its proliferative activity, which is in the opposite direction of apoptosis. This brings up the question of whether silibinin modulates apoptosis after cerebral ischemic injury and whether EGFR is involved in mediating this effect. We therefore examined the potential protective role of silibinin in ischemic brain and the underlying mechanisms. We assigned CD1 mice into groups and assessed neurological function via behavioral tests, infarct volume staining, and edema measurement. Neuronal vitality in the infarcted hemisphere was assessed using Nissl staining, while the level of apoptosis was evaluated by detecting cleaved Caspase-3, Bcl-2, and Bax. Penumbra vascular conditions were examined by immunofluorescence and two-photon imaging. Western Blot and immunohistochemistry detected EGFR/ERK level changes. An EGFR inhibitor was used to confirm the involvement of the EGFR/ERK pathway in the disease process. Our findings indicated that silibinin substantially diminished infarct volume and brain edema, reduced neuronal apoptosis following stroke, enhancing neurological function. These effects were accompanied by up-regulation of p-EGFR/EGFR, p-ERK/ERK, and Bcl-2, as well as down-regulation of Bax and cleaved-Caspase3 in ischemic brain tissue post-stroke, while inhibiting EGFR activation attenuated or reversed the anti-apoptotic effects of silibinin. We concluded that silibinin protected the brain after cerebral ischemia by exerting anti-apoptotic effects via the activation of EGFR/ERK signaling pathway.
format Article
id doaj-art-58d2230d274549919a97162cfa559ae2
institution Kabale University
issn 1873-2747
language English
publishDate 2025-06-01
publisher Elsevier
record_format Article
series Brain Research Bulletin
spelling doaj-art-58d2230d274549919a97162cfa559ae22025-08-20T03:47:45ZengElsevierBrain Research Bulletin1873-27472025-06-0122611135310.1016/j.brainresbull.2025.111353Silibinin protects the ischemic brain in mice by exerting anti-apoptotic effects via the EGFR/ERK pathwayLinlin Li0Wenyan Shang1Yuexia Ma2Cong Zhang3Xiangjian Zhang4Department of Neurology, Second Hospital of Hebei Medical University, Shijiazhuang, Hebei 050000, PR China; Hebei Collaborative Innovation Center for Cardio-Cerebrovascular Disease, Shijiazhuang, Hebei 050000, PR China; Hebei Key Laboratory of Vascular Homeostasis, Shijiazhuang, Hebei 050000, PR ChinaDepartment of Neurology, Second Hospital of Hebei Medical University, Shijiazhuang, Hebei 050000, PR China; Hebei Collaborative Innovation Center for Cardio-Cerebrovascular Disease, Shijiazhuang, Hebei 050000, PR China; Hebei Key Laboratory of Vascular Homeostasis, Shijiazhuang, Hebei 050000, PR ChinaDepartment of Neurology, Second Hospital of Hebei Medical University, Shijiazhuang, Hebei 050000, PR China; Hebei Collaborative Innovation Center for Cardio-Cerebrovascular Disease, Shijiazhuang, Hebei 050000, PR China; Hebei Key Laboratory of Vascular Homeostasis, Shijiazhuang, Hebei 050000, PR ChinaDepartment of Neurology, Second Hospital of Hebei Medical University, Shijiazhuang, Hebei 050000, PR China; Hebei Collaborative Innovation Center for Cardio-Cerebrovascular Disease, Shijiazhuang, Hebei 050000, PR China; Hebei Key Laboratory of Vascular Homeostasis, Shijiazhuang, Hebei 050000, PR ChinaDepartment of Neurology, Second Hospital of Hebei Medical University, Shijiazhuang, Hebei 050000, PR China; Hebei Collaborative Innovation Center for Cardio-Cerebrovascular Disease, Shijiazhuang, Hebei 050000, PR China; Hebei Key Laboratory of Vascular Homeostasis, Shijiazhuang, Hebei 050000, PR China; Corresponding author at: Department of Neurology, Second Hospital of Hebei Medical University, Shijiazhuang, Hebei 050000, PR China.Apoptosis is a significant occurrence of cell death in the cerebral ischemia process, potentially revealing specific treatment points. Silibinin (SIL) has been proven to regulate a range of biological effects on inflammation, oxidative stress and apoptosis. Meanwhile, the epidermal growth factor receptor (EGFR) has been reported to impact cell apoptosis owing to its proliferative activity, which is in the opposite direction of apoptosis. This brings up the question of whether silibinin modulates apoptosis after cerebral ischemic injury and whether EGFR is involved in mediating this effect. We therefore examined the potential protective role of silibinin in ischemic brain and the underlying mechanisms. We assigned CD1 mice into groups and assessed neurological function via behavioral tests, infarct volume staining, and edema measurement. Neuronal vitality in the infarcted hemisphere was assessed using Nissl staining, while the level of apoptosis was evaluated by detecting cleaved Caspase-3, Bcl-2, and Bax. Penumbra vascular conditions were examined by immunofluorescence and two-photon imaging. Western Blot and immunohistochemistry detected EGFR/ERK level changes. An EGFR inhibitor was used to confirm the involvement of the EGFR/ERK pathway in the disease process. Our findings indicated that silibinin substantially diminished infarct volume and brain edema, reduced neuronal apoptosis following stroke, enhancing neurological function. These effects were accompanied by up-regulation of p-EGFR/EGFR, p-ERK/ERK, and Bcl-2, as well as down-regulation of Bax and cleaved-Caspase3 in ischemic brain tissue post-stroke, while inhibiting EGFR activation attenuated or reversed the anti-apoptotic effects of silibinin. We concluded that silibinin protected the brain after cerebral ischemia by exerting anti-apoptotic effects via the activation of EGFR/ERK signaling pathway.http://www.sciencedirect.com/science/article/pii/S0361923025001650Ischemic strokeSilibininApoptosisEGFR/ERKC225Bcl-2
spellingShingle Linlin Li
Wenyan Shang
Yuexia Ma
Cong Zhang
Xiangjian Zhang
Silibinin protects the ischemic brain in mice by exerting anti-apoptotic effects via the EGFR/ERK pathway
Brain Research Bulletin
Ischemic stroke
Silibinin
Apoptosis
EGFR/ERK
C225
Bcl-2
title Silibinin protects the ischemic brain in mice by exerting anti-apoptotic effects via the EGFR/ERK pathway
title_full Silibinin protects the ischemic brain in mice by exerting anti-apoptotic effects via the EGFR/ERK pathway
title_fullStr Silibinin protects the ischemic brain in mice by exerting anti-apoptotic effects via the EGFR/ERK pathway
title_full_unstemmed Silibinin protects the ischemic brain in mice by exerting anti-apoptotic effects via the EGFR/ERK pathway
title_short Silibinin protects the ischemic brain in mice by exerting anti-apoptotic effects via the EGFR/ERK pathway
title_sort silibinin protects the ischemic brain in mice by exerting anti apoptotic effects via the egfr erk pathway
topic Ischemic stroke
Silibinin
Apoptosis
EGFR/ERK
C225
Bcl-2
url http://www.sciencedirect.com/science/article/pii/S0361923025001650
work_keys_str_mv AT linlinli silibininprotectstheischemicbraininmicebyexertingantiapoptoticeffectsviatheegfrerkpathway
AT wenyanshang silibininprotectstheischemicbraininmicebyexertingantiapoptoticeffectsviatheegfrerkpathway
AT yuexiama silibininprotectstheischemicbraininmicebyexertingantiapoptoticeffectsviatheegfrerkpathway
AT congzhang silibininprotectstheischemicbraininmicebyexertingantiapoptoticeffectsviatheegfrerkpathway
AT xiangjianzhang silibininprotectstheischemicbraininmicebyexertingantiapoptoticeffectsviatheegfrerkpathway