Whole Blood Transcriptome Analysis in Dairy Ewes Fed a Dietary Grape Pomace Supplementation
The present study aims to evaluate the effect of a dietary supplementation with 10% grape pomace (GP) on the whole blood transcriptome of lactating ewes. By applying a log<sub>2</sub>FC higher than 0.5 or lower than −0.5 and a false discovery rate (FDR) <0.05, the down-regulation of g...
Saved in:
| Main Authors: | , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2024-11-01
|
| Series: | Veterinary Sciences |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2306-7381/11/11/536 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850147068697378816 |
|---|---|
| author | Andrea Ianni Francesca Bennato Camillo Martino Maria Antonietta Saletti Francesco Pomilio Giuseppe Martino |
| author_facet | Andrea Ianni Francesca Bennato Camillo Martino Maria Antonietta Saletti Francesco Pomilio Giuseppe Martino |
| author_sort | Andrea Ianni |
| collection | DOAJ |
| description | The present study aims to evaluate the effect of a dietary supplementation with 10% grape pomace (GP) on the whole blood transcriptome of lactating ewes. By applying a log<sub>2</sub>FC higher than 0.5 or lower than −0.5 and a false discovery rate (FDR) <0.05, the down-regulation of genes coding for plexin C1, ethanolamine kinase 1, tax1-binding protein 1, transmembrane 9 superfamily member 2, and Beclin-1 was observed in animals that received the dietary supplementation. This aspect was also accompanied by a reduction in the blood activity of matrix metalloproteinase 9 (MMP-9; <i>p</i> < 0.05), a gelatinase commonly involved in both acute and chronic pathological events. The ELISA test on other factors involved in inflammatory processes, interleukin 1 (IL-1) and tumor necrosis factor α (TNF-α), as well as in the antioxidant response, glutathione peroxidase (GPx), and catalase (CAT), did not reveal any significant changes (<i>p</i> > 0.05). Overall, the introduction of GP in the diet of ewes gave indications of greater efficacy in preserving animal welfare, with interesting cues regarding the valorization of a by-product with a high biological value. |
| format | Article |
| id | doaj-art-eade9f5b0eba4865b73ec6222b4781ac |
| institution | OA Journals |
| issn | 2306-7381 |
| language | English |
| publishDate | 2024-11-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Veterinary Sciences |
| spelling | doaj-art-eade9f5b0eba4865b73ec6222b4781ac2025-08-20T02:27:41ZengMDPI AGVeterinary Sciences2306-73812024-11-01111153610.3390/vetsci11110536Whole Blood Transcriptome Analysis in Dairy Ewes Fed a Dietary Grape Pomace SupplementationAndrea Ianni0Francesca Bennato1Camillo Martino2Maria Antonietta Saletti3Francesco Pomilio4Giuseppe Martino5Department of BioScience and Technology for Food, Agriculture, and Environment, University of Teramo, 64100 Teramo, TE, ItalyDepartment of BioScience and Technology for Food, Agriculture, and Environment, University of Teramo, 64100 Teramo, TE, ItalyDepartment of Veterinary Medicine, University of Perugia, 06126 Perugia, PG, ItalyFood Hygiene Unit, NRL for L. Monocytogenes, Istituto Zooprofilattico Sperimentale dell’Abruzzo e del Molise “G. Caporale”, 64100 Teramo, TE, ItalyFood Hygiene Unit, NRL for L. Monocytogenes, Istituto Zooprofilattico Sperimentale dell’Abruzzo e del Molise “G. Caporale”, 64100 Teramo, TE, ItalyDepartment of BioScience and Technology for Food, Agriculture, and Environment, University of Teramo, 64100 Teramo, TE, ItalyThe present study aims to evaluate the effect of a dietary supplementation with 10% grape pomace (GP) on the whole blood transcriptome of lactating ewes. By applying a log<sub>2</sub>FC higher than 0.5 or lower than −0.5 and a false discovery rate (FDR) <0.05, the down-regulation of genes coding for plexin C1, ethanolamine kinase 1, tax1-binding protein 1, transmembrane 9 superfamily member 2, and Beclin-1 was observed in animals that received the dietary supplementation. This aspect was also accompanied by a reduction in the blood activity of matrix metalloproteinase 9 (MMP-9; <i>p</i> < 0.05), a gelatinase commonly involved in both acute and chronic pathological events. The ELISA test on other factors involved in inflammatory processes, interleukin 1 (IL-1) and tumor necrosis factor α (TNF-α), as well as in the antioxidant response, glutathione peroxidase (GPx), and catalase (CAT), did not reveal any significant changes (<i>p</i> > 0.05). Overall, the introduction of GP in the diet of ewes gave indications of greater efficacy in preserving animal welfare, with interesting cues regarding the valorization of a by-product with a high biological value.https://www.mdpi.com/2306-7381/11/11/536dairy ewesanimal welfaregrape pomacetranscriptomicsRNA-seq |
| spellingShingle | Andrea Ianni Francesca Bennato Camillo Martino Maria Antonietta Saletti Francesco Pomilio Giuseppe Martino Whole Blood Transcriptome Analysis in Dairy Ewes Fed a Dietary Grape Pomace Supplementation Veterinary Sciences dairy ewes animal welfare grape pomace transcriptomics RNA-seq |
| title | Whole Blood Transcriptome Analysis in Dairy Ewes Fed a Dietary Grape Pomace Supplementation |
| title_full | Whole Blood Transcriptome Analysis in Dairy Ewes Fed a Dietary Grape Pomace Supplementation |
| title_fullStr | Whole Blood Transcriptome Analysis in Dairy Ewes Fed a Dietary Grape Pomace Supplementation |
| title_full_unstemmed | Whole Blood Transcriptome Analysis in Dairy Ewes Fed a Dietary Grape Pomace Supplementation |
| title_short | Whole Blood Transcriptome Analysis in Dairy Ewes Fed a Dietary Grape Pomace Supplementation |
| title_sort | whole blood transcriptome analysis in dairy ewes fed a dietary grape pomace supplementation |
| topic | dairy ewes animal welfare grape pomace transcriptomics RNA-seq |
| url | https://www.mdpi.com/2306-7381/11/11/536 |
| work_keys_str_mv | AT andreaianni wholebloodtranscriptomeanalysisindairyewesfedadietarygrapepomacesupplementation AT francescabennato wholebloodtranscriptomeanalysisindairyewesfedadietarygrapepomacesupplementation AT camillomartino wholebloodtranscriptomeanalysisindairyewesfedadietarygrapepomacesupplementation AT mariaantoniettasaletti wholebloodtranscriptomeanalysisindairyewesfedadietarygrapepomacesupplementation AT francescopomilio wholebloodtranscriptomeanalysisindairyewesfedadietarygrapepomacesupplementation AT giuseppemartino wholebloodtranscriptomeanalysisindairyewesfedadietarygrapepomacesupplementation |