Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico

bapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with th...

Full description

Saved in:
Bibliographic Details
Main Authors: Gabriela Silva-Hidalgo, Martin López-Valenzuela, Nora Cárcamo-Aréchiga, Silvia Cota-Guajardo, Mayra López-Salazar, Edith Montiel-Vázquez
Format: Article
Language:English
Published: Wiley 2016-01-01
Series:Veterinary Medicine International
Online Access:http://dx.doi.org/10.1155/2016/3478746
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1832548710688489472
author Gabriela Silva-Hidalgo
Martin López-Valenzuela
Nora Cárcamo-Aréchiga
Silvia Cota-Guajardo
Mayra López-Salazar
Edith Montiel-Vázquez
author_facet Gabriela Silva-Hidalgo
Martin López-Valenzuela
Nora Cárcamo-Aréchiga
Silvia Cota-Guajardo
Mayra López-Salazar
Edith Montiel-Vázquez
author_sort Gabriela Silva-Hidalgo
collection DOAJ
description bapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with the ability to persist in different environments, which contributes to the pathogenicity of several species. We analyzed the presence of bapA in 83 strains belonging to 17 serovars of Salmonella enterica subsp. enterica from wildlife in captivity at Culiacan’s Zoo and Mazatlán’s Aquarium. Each isolate amplified a product of 667 bp, which corresponds to the expected size of the bapA initiator, with no observed variation between different serovars analyzed. bapA gene was found to be highly conserved in Salmonella and can be targeted for the genus-specific detection of this organism from different sources. Since bapA expression improves bacterial proliferation outside of the host and facilitates resistance to disinfectants and desiccation, the survival of Salmonella in natural habitats may be favored. Thus, the risk of bacterial contamination from these animals is increased.
format Article
id doaj-art-e70e2109625745eea0a5ce6b2d123540
institution Kabale University
issn 2090-8113
2042-0048
language English
publishDate 2016-01-01
publisher Wiley
record_format Article
series Veterinary Medicine International
spelling doaj-art-e70e2109625745eea0a5ce6b2d1235402025-02-03T06:13:23ZengWileyVeterinary Medicine International2090-81132042-00482016-01-01201610.1155/2016/34787463478746Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, MexicoGabriela Silva-Hidalgo0Martin López-Valenzuela1Nora Cárcamo-Aréchiga2Silvia Cota-Guajardo3Mayra López-Salazar4Edith Montiel-Vázquez5Pathology Laboratory, Faculty of Veterinary Medicine and Animal Husbandry, Autonomous University of Sinaloa, Boulevard San Ángel s/n, Fraccionamiento San Benito, 80246 Culiacán, SIN, MexicoPathology Laboratory, Faculty of Veterinary Medicine and Animal Husbandry, Autonomous University of Sinaloa, Boulevard San Ángel s/n, Fraccionamiento San Benito, 80246 Culiacán, SIN, MexicoPathology Laboratory, Faculty of Veterinary Medicine and Animal Husbandry, Autonomous University of Sinaloa, Boulevard San Ángel s/n, Fraccionamiento San Benito, 80246 Culiacán, SIN, MexicoPathology Laboratory, Faculty of Veterinary Medicine and Animal Husbandry, Autonomous University of Sinaloa, Boulevard San Ángel s/n, Fraccionamiento San Benito, 80246 Culiacán, SIN, MexicoPathology Laboratory, Faculty of Veterinary Medicine and Animal Husbandry, Autonomous University of Sinaloa, Boulevard San Ángel s/n, Fraccionamiento San Benito, 80246 Culiacán, SIN, MexicoEnteric Bacteriology Laboratory, Institute of Epidemiological Diagnosis and Reference, Francisco de P. Miranda 177, Lomas de Plateros, Álvaro Obregón, 01480 Mexico City, DF, MexicobapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with the ability to persist in different environments, which contributes to the pathogenicity of several species. We analyzed the presence of bapA in 83 strains belonging to 17 serovars of Salmonella enterica subsp. enterica from wildlife in captivity at Culiacan’s Zoo and Mazatlán’s Aquarium. Each isolate amplified a product of 667 bp, which corresponds to the expected size of the bapA initiator, with no observed variation between different serovars analyzed. bapA gene was found to be highly conserved in Salmonella and can be targeted for the genus-specific detection of this organism from different sources. Since bapA expression improves bacterial proliferation outside of the host and facilitates resistance to disinfectants and desiccation, the survival of Salmonella in natural habitats may be favored. Thus, the risk of bacterial contamination from these animals is increased.http://dx.doi.org/10.1155/2016/3478746
spellingShingle Gabriela Silva-Hidalgo
Martin López-Valenzuela
Nora Cárcamo-Aréchiga
Silvia Cota-Guajardo
Mayra López-Salazar
Edith Montiel-Vázquez
Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
Veterinary Medicine International
title Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title_full Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title_fullStr Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title_full_unstemmed Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title_short Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title_sort identification of bapa in strains of salmonella enterica subsp enterica isolated from wild animals kept in captivity in sinaloa mexico
url http://dx.doi.org/10.1155/2016/3478746
work_keys_str_mv AT gabrielasilvahidalgo identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico
AT martinlopezvalenzuela identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico
AT noracarcamoarechiga identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico
AT silviacotaguajardo identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico
AT mayralopezsalazar identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico
AT edithmontielvazquez identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico