Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
bapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with th...
Saved in:
| Main Authors: | , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2016-01-01
|
| Series: | Veterinary Medicine International |
| Online Access: | http://dx.doi.org/10.1155/2016/3478746 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832548710688489472 |
|---|---|
| author | Gabriela Silva-Hidalgo Martin López-Valenzuela Nora Cárcamo-Aréchiga Silvia Cota-Guajardo Mayra López-Salazar Edith Montiel-Vázquez |
| author_facet | Gabriela Silva-Hidalgo Martin López-Valenzuela Nora Cárcamo-Aréchiga Silvia Cota-Guajardo Mayra López-Salazar Edith Montiel-Vázquez |
| author_sort | Gabriela Silva-Hidalgo |
| collection | DOAJ |
| description | bapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with the ability to persist in different environments, which contributes to the pathogenicity of several species. We analyzed the presence of bapA in 83 strains belonging to 17 serovars of Salmonella enterica subsp. enterica from wildlife in captivity at Culiacan’s Zoo and Mazatlán’s Aquarium. Each isolate amplified a product of 667 bp, which corresponds to the expected size of the bapA initiator, with no observed variation between different serovars analyzed. bapA gene was found to be highly conserved in Salmonella and can be targeted for the genus-specific detection of this organism from different sources. Since bapA expression improves bacterial proliferation outside of the host and facilitates resistance to disinfectants and desiccation, the survival of Salmonella in natural habitats may be favored. Thus, the risk of bacterial contamination from these animals is increased. |
| format | Article |
| id | doaj-art-e70e2109625745eea0a5ce6b2d123540 |
| institution | Kabale University |
| issn | 2090-8113 2042-0048 |
| language | English |
| publishDate | 2016-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | Veterinary Medicine International |
| spelling | doaj-art-e70e2109625745eea0a5ce6b2d1235402025-02-03T06:13:23ZengWileyVeterinary Medicine International2090-81132042-00482016-01-01201610.1155/2016/34787463478746Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, MexicoGabriela Silva-Hidalgo0Martin López-Valenzuela1Nora Cárcamo-Aréchiga2Silvia Cota-Guajardo3Mayra López-Salazar4Edith Montiel-Vázquez5Pathology Laboratory, Faculty of Veterinary Medicine and Animal Husbandry, Autonomous University of Sinaloa, Boulevard San Ángel s/n, Fraccionamiento San Benito, 80246 Culiacán, SIN, MexicoPathology Laboratory, Faculty of Veterinary Medicine and Animal Husbandry, Autonomous University of Sinaloa, Boulevard San Ángel s/n, Fraccionamiento San Benito, 80246 Culiacán, SIN, MexicoPathology Laboratory, Faculty of Veterinary Medicine and Animal Husbandry, Autonomous University of Sinaloa, Boulevard San Ángel s/n, Fraccionamiento San Benito, 80246 Culiacán, SIN, MexicoPathology Laboratory, Faculty of Veterinary Medicine and Animal Husbandry, Autonomous University of Sinaloa, Boulevard San Ángel s/n, Fraccionamiento San Benito, 80246 Culiacán, SIN, MexicoPathology Laboratory, Faculty of Veterinary Medicine and Animal Husbandry, Autonomous University of Sinaloa, Boulevard San Ángel s/n, Fraccionamiento San Benito, 80246 Culiacán, SIN, MexicoEnteric Bacteriology Laboratory, Institute of Epidemiological Diagnosis and Reference, Francisco de P. Miranda 177, Lomas de Plateros, Álvaro Obregón, 01480 Mexico City, DF, MexicobapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with the ability to persist in different environments, which contributes to the pathogenicity of several species. We analyzed the presence of bapA in 83 strains belonging to 17 serovars of Salmonella enterica subsp. enterica from wildlife in captivity at Culiacan’s Zoo and Mazatlán’s Aquarium. Each isolate amplified a product of 667 bp, which corresponds to the expected size of the bapA initiator, with no observed variation between different serovars analyzed. bapA gene was found to be highly conserved in Salmonella and can be targeted for the genus-specific detection of this organism from different sources. Since bapA expression improves bacterial proliferation outside of the host and facilitates resistance to disinfectants and desiccation, the survival of Salmonella in natural habitats may be favored. Thus, the risk of bacterial contamination from these animals is increased.http://dx.doi.org/10.1155/2016/3478746 |
| spellingShingle | Gabriela Silva-Hidalgo Martin López-Valenzuela Nora Cárcamo-Aréchiga Silvia Cota-Guajardo Mayra López-Salazar Edith Montiel-Vázquez Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico Veterinary Medicine International |
| title | Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
| title_full | Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
| title_fullStr | Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
| title_full_unstemmed | Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
| title_short | Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
| title_sort | identification of bapa in strains of salmonella enterica subsp enterica isolated from wild animals kept in captivity in sinaloa mexico |
| url | http://dx.doi.org/10.1155/2016/3478746 |
| work_keys_str_mv | AT gabrielasilvahidalgo identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico AT martinlopezvalenzuela identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico AT noracarcamoarechiga identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico AT silviacotaguajardo identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico AT mayralopezsalazar identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico AT edithmontielvazquez identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico |