Importance of winter pea cv. Maksimirski rani in milk production on family farms

Forage pea (Pisum sativum L.) is gaining importance as a forage legume in the Republic of Croatia. Pea seed contains 20-30 percent of protein, it is utilized without thermal treatment in feeding different types and categories of livestock, and with stable yield it provides an appreciable income per...

Full description

Saved in:
Bibliographic Details
Main Authors: Darko Uher, Zvonimir Štafa, Mihaela Blažinkov, Ana Pisačić, Martina Kmet, Maja Ščavničar
Format: Article
Language:English
Published: Croatian Dairy Union 2010-03-01
Series:Mljekarstvo
Subjects:
Online Access:http://hrcak.srce.hr/index.php?show=clanak&id_clanak_jezik=76088
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850165998883176448
author Darko Uher
Zvonimir Štafa
Mihaela Blažinkov
Ana Pisačić
Martina Kmet
Maja Ščavničar
author_facet Darko Uher
Zvonimir Štafa
Mihaela Blažinkov
Ana Pisačić
Martina Kmet
Maja Ščavničar
author_sort Darko Uher
collection DOAJ
description Forage pea (Pisum sativum L.) is gaining importance as a forage legume in the Republic of Croatia. Pea seed contains 20-30 percent of protein, it is utilized without thermal treatment in feeding different types and categories of livestock, and with stable yield it provides an appreciable income per hectare. Two-year field trials (2005-2006) were carried out to determine the effect of winter pea seed inoculation and nitrogen top-dressing on the number and mass (g/plant-1) of root nodules and also on the yield and quality of winter pea cv. Maksimirski rani in a mixture with wheat cv. Sana. Just before sowing, pea seeds were inoculated with the strain Rhizobium leguminosarum bv. viciae 1001 from the microbial collection of the Department of Microbiology, Faculty of Agriculture, University of Zagreb. The highest number of root nodules (43 nodules/plant), as well as the highest nodule mass (0.219 g/plant-1) were determined in the inoculated variant. The highest number of pods (19.0) and seeds per plant (60) were determined in the inoculated variant as well. The highest 1000-seed mass (132 g) and seed mass per plant (7.93 g) were also determined in the inoculated variant. Average pea seed yield ranged from 2949 kg ha-1 (control) up to 3353 kg ha-1 (inoculation). The conclusion of this research is that the highest seed (3353 kg ha-1) and crude protein yields (833 kg ha-1) were obtained with inoculated forage winter pea cv. Maksimirski rani. Seed inoculation of the studied pea cultivar Maksimirski rani with the strain Rhizobium leguminosarum bv. viciae 1001 influenced also higher milk production per hectare compared to the control and the nitrogen top-dressed variant.
format Article
id doaj-art-e48f41be92b44d67ae33a26573b856c0
institution OA Journals
issn 0026-704X
1846-4025
language English
publishDate 2010-03-01
publisher Croatian Dairy Union
record_format Article
series Mljekarstvo
spelling doaj-art-e48f41be92b44d67ae33a26573b856c02025-08-20T02:21:34ZengCroatian Dairy UnionMljekarstvo0026-704X1846-40252010-03-016013749Importance of winter pea cv. Maksimirski rani in milk production on family farmsDarko UherZvonimir ŠtafaMihaela BlažinkovAna PisačićMartina KmetMaja ŠčavničarForage pea (Pisum sativum L.) is gaining importance as a forage legume in the Republic of Croatia. Pea seed contains 20-30 percent of protein, it is utilized without thermal treatment in feeding different types and categories of livestock, and with stable yield it provides an appreciable income per hectare. Two-year field trials (2005-2006) were carried out to determine the effect of winter pea seed inoculation and nitrogen top-dressing on the number and mass (g/plant-1) of root nodules and also on the yield and quality of winter pea cv. Maksimirski rani in a mixture with wheat cv. Sana. Just before sowing, pea seeds were inoculated with the strain Rhizobium leguminosarum bv. viciae 1001 from the microbial collection of the Department of Microbiology, Faculty of Agriculture, University of Zagreb. The highest number of root nodules (43 nodules/plant), as well as the highest nodule mass (0.219 g/plant-1) were determined in the inoculated variant. The highest number of pods (19.0) and seeds per plant (60) were determined in the inoculated variant as well. The highest 1000-seed mass (132 g) and seed mass per plant (7.93 g) were also determined in the inoculated variant. Average pea seed yield ranged from 2949 kg ha-1 (control) up to 3353 kg ha-1 (inoculation). The conclusion of this research is that the highest seed (3353 kg ha-1) and crude protein yields (833 kg ha-1) were obtained with inoculated forage winter pea cv. Maksimirski rani. Seed inoculation of the studied pea cultivar Maksimirski rani with the strain Rhizobium leguminosarum bv. viciae 1001 influenced also higher milk production per hectare compared to the control and the nitrogen top-dressed variant.http://hrcak.srce.hr/index.php?show=clanak&id_clanak_jezik=76088winter peainoculationnitrogen top-dressingseed yieldquality
spellingShingle Darko Uher
Zvonimir Štafa
Mihaela Blažinkov
Ana Pisačić
Martina Kmet
Maja Ščavničar
Importance of winter pea cv. Maksimirski rani in milk production on family farms
Mljekarstvo
winter pea
inoculation
nitrogen top-dressing
seed yield
quality
title Importance of winter pea cv. Maksimirski rani in milk production on family farms
title_full Importance of winter pea cv. Maksimirski rani in milk production on family farms
title_fullStr Importance of winter pea cv. Maksimirski rani in milk production on family farms
title_full_unstemmed Importance of winter pea cv. Maksimirski rani in milk production on family farms
title_short Importance of winter pea cv. Maksimirski rani in milk production on family farms
title_sort importance of winter pea cv maksimirski rani in milk production on family farms
topic winter pea
inoculation
nitrogen top-dressing
seed yield
quality
url http://hrcak.srce.hr/index.php?show=clanak&id_clanak_jezik=76088
work_keys_str_mv AT darkouher importanceofwinterpeacvmaksimirskiraniinmilkproductiononfamilyfarms
AT zvonimirstafa importanceofwinterpeacvmaksimirskiraniinmilkproductiononfamilyfarms
AT mihaelablazinkov importanceofwinterpeacvmaksimirskiraniinmilkproductiononfamilyfarms
AT anapisacic importanceofwinterpeacvmaksimirskiraniinmilkproductiononfamilyfarms
AT martinakmet importanceofwinterpeacvmaksimirskiraniinmilkproductiononfamilyfarms
AT majascavnicar importanceofwinterpeacvmaksimirskiraniinmilkproductiononfamilyfarms