Centridini Bees as Manageable Pollinators of West Indian Cherry (Malpighia emarginata, Malpighiaceae) Orchards in Southeast Brazil
The West Indian cherry (Malpighia emarginata), commonly referred to as “Acerola”, has attracted particular interest due to its high vitamin C content in the fruit. One of the limitations observed in Acerola crops is their dependence on cross-pollination, which is usually performed by Centris specie...
Saved in:
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Universidade Estadual de Feira de Santana
2025-07-01
|
| Series: | Sociobiology |
| Subjects: | |
| Online Access: | https://periodicos.uefs.br/index.php/sociobiology/article/view/11415 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849698096521412608 |
|---|---|
| author | Diego Moure-Oliveira Reinanda Lima Morgana S. Sazan Cláudia Inês Silva Carlos A. Garófalo |
| author_facet | Diego Moure-Oliveira Reinanda Lima Morgana S. Sazan Cláudia Inês Silva Carlos A. Garófalo |
| author_sort | Diego Moure-Oliveira |
| collection | DOAJ |
| description |
The West Indian cherry (Malpighia emarginata), commonly referred to as “Acerola”, has attracted particular interest due to its high vitamin C content in the fruit. One of the limitations observed in Acerola crops is their dependence on cross-pollination, which is usually performed by Centris species. This study investigated the occupation of trap-nests in an Acerola orchard by bees of the genus Centris to identify species that could be indicated as providers of pollination services in these orchards. Centris analis and Centris tarsata, the species occupying the traps, displayed a seasonal pattern in their nesting activities, with the highest frequencies aligning with the peaks of the crop’s flowering. Both bees explored 48 plant species, with M. emarginata being the most important pollen source and floral oil, primarily for C. analis. The high preference observed in the diet of C. analis and the seasonal pattern in the nesting activity of C. tarsata indicate that both species are effective pollinators of M. emarginata crops.
|
| format | Article |
| id | doaj-art-d58d7f1003074d1dbce2d20e8aaff878 |
| institution | DOAJ |
| issn | 0361-6525 2447-8067 |
| language | English |
| publishDate | 2025-07-01 |
| publisher | Universidade Estadual de Feira de Santana |
| record_format | Article |
| series | Sociobiology |
| spelling | doaj-art-d58d7f1003074d1dbce2d20e8aaff8782025-08-20T03:19:00ZengUniversidade Estadual de Feira de SantanaSociobiology0361-65252447-80672025-07-0172310.13102/sociobiology.v72i3.11415Centridini Bees as Manageable Pollinators of West Indian Cherry (Malpighia emarginata, Malpighiaceae) Orchards in Southeast BrazilDiego Moure-Oliveira0Reinanda Lima1Morgana S. Sazan2Cláudia Inês Silva3Carlos A. Garófalo4Departamento de Biologia, Faculdade de Filosofia, Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, Ribeirão Preto-SP, BrazilDepartamento de Biologia, Faculdade de Filosofia, Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, Ribeirão Preto-SP, BrazilDepartamento de Biologia, Faculdade de Filosofia, Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, Ribeirão Preto-SP, BrazilPrograma de Pós-Graduação em Biodiversidade e Evolução, Museu Paraense Emílio Goeldi, Belém-PA, BrazilDepartamento de Biologia, Faculdade de Filosofia, Ciências e Letras de Ribeirão Preto, Universidade de São Paulo, Ribeirão Preto-SP, Brazil The West Indian cherry (Malpighia emarginata), commonly referred to as “Acerola”, has attracted particular interest due to its high vitamin C content in the fruit. One of the limitations observed in Acerola crops is their dependence on cross-pollination, which is usually performed by Centris species. This study investigated the occupation of trap-nests in an Acerola orchard by bees of the genus Centris to identify species that could be indicated as providers of pollination services in these orchards. Centris analis and Centris tarsata, the species occupying the traps, displayed a seasonal pattern in their nesting activities, with the highest frequencies aligning with the peaks of the crop’s flowering. Both bees explored 48 plant species, with M. emarginata being the most important pollen source and floral oil, primarily for C. analis. The high preference observed in the diet of C. analis and the seasonal pattern in the nesting activity of C. tarsata indicate that both species are effective pollinators of M. emarginata crops. https://periodicos.uefs.br/index.php/sociobiology/article/view/11415agriculturepollinationCentrissolitary beesnest substrate availability |
| spellingShingle | Diego Moure-Oliveira Reinanda Lima Morgana S. Sazan Cláudia Inês Silva Carlos A. Garófalo Centridini Bees as Manageable Pollinators of West Indian Cherry (Malpighia emarginata, Malpighiaceae) Orchards in Southeast Brazil Sociobiology agriculture pollination Centris solitary bees nest substrate availability |
| title | Centridini Bees as Manageable Pollinators of West Indian Cherry (Malpighia emarginata, Malpighiaceae) Orchards in Southeast Brazil |
| title_full | Centridini Bees as Manageable Pollinators of West Indian Cherry (Malpighia emarginata, Malpighiaceae) Orchards in Southeast Brazil |
| title_fullStr | Centridini Bees as Manageable Pollinators of West Indian Cherry (Malpighia emarginata, Malpighiaceae) Orchards in Southeast Brazil |
| title_full_unstemmed | Centridini Bees as Manageable Pollinators of West Indian Cherry (Malpighia emarginata, Malpighiaceae) Orchards in Southeast Brazil |
| title_short | Centridini Bees as Manageable Pollinators of West Indian Cherry (Malpighia emarginata, Malpighiaceae) Orchards in Southeast Brazil |
| title_sort | centridini bees as manageable pollinators of west indian cherry malpighia emarginata malpighiaceae orchards in southeast brazil |
| topic | agriculture pollination Centris solitary bees nest substrate availability |
| url | https://periodicos.uefs.br/index.php/sociobiology/article/view/11415 |
| work_keys_str_mv | AT diegomoureoliveira centridinibeesasmanageablepollinatorsofwestindiancherrymalpighiaemarginatamalpighiaceaeorchardsinsoutheastbrazil AT reinandalima centridinibeesasmanageablepollinatorsofwestindiancherrymalpighiaemarginatamalpighiaceaeorchardsinsoutheastbrazil AT morganassazan centridinibeesasmanageablepollinatorsofwestindiancherrymalpighiaemarginatamalpighiaceaeorchardsinsoutheastbrazil AT claudiainessilva centridinibeesasmanageablepollinatorsofwestindiancherrymalpighiaemarginatamalpighiaceaeorchardsinsoutheastbrazil AT carlosagarofalo centridinibeesasmanageablepollinatorsofwestindiancherrymalpighiaemarginatamalpighiaceaeorchardsinsoutheastbrazil |