The Complete Chloroplast Genome of the Vietnamese Endemic Species Aquilaria banaense P.H. Hô, 1986 (Thymelaeaceae): Structure, Evolution, and Phylogeny
ABSTRACT The genus Aquilaria (Thymelaeaceae) is renowned for producing agarwood, a highly valuable resinous product of significant economic and cultural value. Yet, many of its species, including the endemic Aquilaria banaense from Vietnam, face conservation challenges due to overexploitation. This...
Saved in:
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2025-07-01
|
| Series: | Ecology and Evolution |
| Subjects: | |
| Online Access: | https://doi.org/10.1002/ece3.71708 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849731064259411968 |
|---|---|
| author | Yen Thi Van Ngoc Bao Mach Thanh‐Thuy Duong Thang Nam Tran Nguyen Van Minh Tan Duy Ngoc Nguyen Hoang Dang Khoa Do Thiet Minh Vu |
| author_facet | Yen Thi Van Ngoc Bao Mach Thanh‐Thuy Duong Thang Nam Tran Nguyen Van Minh Tan Duy Ngoc Nguyen Hoang Dang Khoa Do Thiet Minh Vu |
| author_sort | Yen Thi Van |
| collection | DOAJ |
| description | ABSTRACT The genus Aquilaria (Thymelaeaceae) is renowned for producing agarwood, a highly valuable resinous product of significant economic and cultural value. Yet, many of its species, including the endemic Aquilaria banaense from Vietnam, face conservation challenges due to overexploitation. This study presents the first complete chloroplast (cp) genome of A. banaense to investigate its genome structure, evolutionary characteristics, and phylogenetic position. The cp genome of A. banaense was 174,810 bp, exhibiting a typical quadripartite structure with a large single‐copy (LSC) region (87,264 bp), a small single‐copy (SSC) region (3342 bp), and two inverted repeat (IR) regions (42,102 bp), encoding unique 79 protein‐coding genes, 30 tRNA genes, and four rRNA genes. Comparative analysis across Aquilaria species revealed conserved genomic features, including IR expansion into the SSC region, absence of clpP1 introns, alongside moderate nucleotide divergent regions (such as matK‐rps16, petN‐trnT‐GGU, rps4‐ndhJ, and ndhF‐rpl32) and a distinct accD variant in A. banaense. Phylogenetic reconstruction using whole cp genomes of 13 Aquilaria species placed A. banaense sister to mainland Southeast Asian species like A. crassna and A. subintegra, clearly separated from insular Southeast Asian groups. The correlation between phylogenetic structure and geographic distribution suggests that historical biogeography and ecological factors have driven lineage divergence in Aquilaria. These findings highlight the genetic distinctiveness of A. banaense and provide valuable genetic resources for species identification and conservation planning for this vulnerable species. |
| format | Article |
| id | doaj-art-d1998ba66b624c838f592b68bd66e2ba |
| institution | DOAJ |
| issn | 2045-7758 |
| language | English |
| publishDate | 2025-07-01 |
| publisher | Wiley |
| record_format | Article |
| series | Ecology and Evolution |
| spelling | doaj-art-d1998ba66b624c838f592b68bd66e2ba2025-08-20T03:08:40ZengWileyEcology and Evolution2045-77582025-07-01157n/an/a10.1002/ece3.71708The Complete Chloroplast Genome of the Vietnamese Endemic Species Aquilaria banaense P.H. Hô, 1986 (Thymelaeaceae): Structure, Evolution, and PhylogenyYen Thi Van0Ngoc Bao Mach1Thanh‐Thuy Duong2Thang Nam Tran3Nguyen Van Minh4Tan Duy Ngoc Nguyen5Hoang Dang Khoa Do6Thiet Minh Vu7University of Agriculture and Forestry Hue University Hue City VietnamFunctional Genomic Research Center, NTT Hi‐Tech Institute Nguyen Tat Thanh University Ho Chi Minh City VietnamUniversity of Agriculture and Forestry Hue University Hue City VietnamUniversity of Agriculture and Forestry Hue University Hue City VietnamUniversity of Agriculture and Forestry Hue University Hue City VietnamUniversity of Agriculture and Forestry Hue University Hue City VietnamFunctional Genomic Research Center, NTT Hi‐Tech Institute Nguyen Tat Thanh University Ho Chi Minh City VietnamFunctional Genomic Research Center, NTT Hi‐Tech Institute Nguyen Tat Thanh University Ho Chi Minh City VietnamABSTRACT The genus Aquilaria (Thymelaeaceae) is renowned for producing agarwood, a highly valuable resinous product of significant economic and cultural value. Yet, many of its species, including the endemic Aquilaria banaense from Vietnam, face conservation challenges due to overexploitation. This study presents the first complete chloroplast (cp) genome of A. banaense to investigate its genome structure, evolutionary characteristics, and phylogenetic position. The cp genome of A. banaense was 174,810 bp, exhibiting a typical quadripartite structure with a large single‐copy (LSC) region (87,264 bp), a small single‐copy (SSC) region (3342 bp), and two inverted repeat (IR) regions (42,102 bp), encoding unique 79 protein‐coding genes, 30 tRNA genes, and four rRNA genes. Comparative analysis across Aquilaria species revealed conserved genomic features, including IR expansion into the SSC region, absence of clpP1 introns, alongside moderate nucleotide divergent regions (such as matK‐rps16, petN‐trnT‐GGU, rps4‐ndhJ, and ndhF‐rpl32) and a distinct accD variant in A. banaense. Phylogenetic reconstruction using whole cp genomes of 13 Aquilaria species placed A. banaense sister to mainland Southeast Asian species like A. crassna and A. subintegra, clearly separated from insular Southeast Asian groups. The correlation between phylogenetic structure and geographic distribution suggests that historical biogeography and ecological factors have driven lineage divergence in Aquilaria. These findings highlight the genetic distinctiveness of A. banaense and provide valuable genetic resources for species identification and conservation planning for this vulnerable species.https://doi.org/10.1002/ece3.71708agarwoodAquilariacomparative genomicsgenetic conservationphylogeography |
| spellingShingle | Yen Thi Van Ngoc Bao Mach Thanh‐Thuy Duong Thang Nam Tran Nguyen Van Minh Tan Duy Ngoc Nguyen Hoang Dang Khoa Do Thiet Minh Vu The Complete Chloroplast Genome of the Vietnamese Endemic Species Aquilaria banaense P.H. Hô, 1986 (Thymelaeaceae): Structure, Evolution, and Phylogeny Ecology and Evolution agarwood Aquilaria comparative genomics genetic conservation phylogeography |
| title | The Complete Chloroplast Genome of the Vietnamese Endemic Species Aquilaria banaense P.H. Hô, 1986 (Thymelaeaceae): Structure, Evolution, and Phylogeny |
| title_full | The Complete Chloroplast Genome of the Vietnamese Endemic Species Aquilaria banaense P.H. Hô, 1986 (Thymelaeaceae): Structure, Evolution, and Phylogeny |
| title_fullStr | The Complete Chloroplast Genome of the Vietnamese Endemic Species Aquilaria banaense P.H. Hô, 1986 (Thymelaeaceae): Structure, Evolution, and Phylogeny |
| title_full_unstemmed | The Complete Chloroplast Genome of the Vietnamese Endemic Species Aquilaria banaense P.H. Hô, 1986 (Thymelaeaceae): Structure, Evolution, and Phylogeny |
| title_short | The Complete Chloroplast Genome of the Vietnamese Endemic Species Aquilaria banaense P.H. Hô, 1986 (Thymelaeaceae): Structure, Evolution, and Phylogeny |
| title_sort | complete chloroplast genome of the vietnamese endemic species aquilaria banaense p h ho 1986 thymelaeaceae structure evolution and phylogeny |
| topic | agarwood Aquilaria comparative genomics genetic conservation phylogeography |
| url | https://doi.org/10.1002/ece3.71708 |
| work_keys_str_mv | AT yenthivan thecompletechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT ngocbaomach thecompletechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT thanhthuyduong thecompletechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT thangnamtran thecompletechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT nguyenvanminh thecompletechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT tanduyngocnguyen thecompletechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT hoangdangkhoado thecompletechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT thietminhvu thecompletechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT yenthivan completechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT ngocbaomach completechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT thanhthuyduong completechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT thangnamtran completechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT nguyenvanminh completechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT tanduyngocnguyen completechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT hoangdangkhoado completechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny AT thietminhvu completechloroplastgenomeofthevietnameseendemicspeciesaquilariabanaensephho1986thymelaeaceaestructureevolutionandphylogeny |