Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review
Background: The interpretation of Down syndrome screening results in assisted reproductive technology (ART) pregnancies is challenging. Despite the high psychological burden that false positive results impose on parents, studies that have addressed interpretation of both serum and sonographic marke...
Saved in:
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Shahid Sadoughi University of Medical Sciences
2025-05-01
|
| Series: | International Journal of Reproductive BioMedicine |
| Subjects: | |
| Online Access: | https://knepublishing.com/index.php/ijrm/article/view/18773 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849688181867282432 |
|---|---|
| author | Fatemeh Zahra Meamar Mitra Savabi-Esfahani Tahmineh Farajkhoda |
| author_facet | Fatemeh Zahra Meamar Mitra Savabi-Esfahani Tahmineh Farajkhoda |
| author_sort | Fatemeh Zahra Meamar |
| collection | DOAJ |
| description |
Background: The interpretation of Down syndrome screening results in assisted reproductive technology (ART) pregnancies is challenging. Despite the high psychological burden that false positive results impose on parents, studies that have addressed interpretation of both serum and sonographic markers in both rounds of screening for Down syndrome diagnosis in post-ART pregnancies are limited.
Objective: This review study investigated the types of serum screening and imaging for prenatal diagnosis of Down syndrome in ART pregnancies to know and correctly interpret the results of prenatal screenings in these pregnancies.
Materials and Methods: In this systematic review, an extensive search was conducted in Persian and English in PubMed, Web of Science, Scopus, SID, and Google Scholar without any time limit until January 2024 using appropriate keywords. PRISMA guideline, STROBE, and CONSORT checklists were used.
Results: Review of 30 articles showed in the first screening, pregnancy-associated plasma protein-A was significantly lower than normal values compared to spontaneous pregnancies, while free beta-human chorionic gonadotropin, especially in the in vitro fertilization (IVF) and intracytoplasmic sperm injection (ICSI) was significantly higher. Some studies also indicated an increase in nuchal translucency in the first trimester of pregnancies resulting from ART.. Biochemical markers of second screening, in some studies, showed an increase in inhibin-A, a decrease in α-fetoprotein, and unconjugated estriol were evident compared to normal values.
Conclusion: Marker levels may be different for the presence of ovulation-stimulating hormones, multiple corpora lutea, twins or multiplets, type of IVF, and changes in egg cytoplasm in ICSI. Study suggests concentration of maternal serum markers, especially free beta-human chorionic gonadotropin and pregnancy-associated plasma protein-A, should be adjusted differently for each ART (IVF and ICSI separately).
|
| format | Article |
| id | doaj-art-ced96014a3e2431f930d2e12f3cc2b9b |
| institution | DOAJ |
| issn | 2476-4108 2476-3772 |
| language | English |
| publishDate | 2025-05-01 |
| publisher | Shahid Sadoughi University of Medical Sciences |
| record_format | Article |
| series | International Journal of Reproductive BioMedicine |
| spelling | doaj-art-ced96014a3e2431f930d2e12f3cc2b9b2025-08-20T03:22:04ZengShahid Sadoughi University of Medical SciencesInternational Journal of Reproductive BioMedicine2476-41082476-37722025-05-0123310.18502/ijrm.v23i3.18773Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic reviewFatemeh Zahra Meamar0Mitra Savabi-Esfahani1Tahmineh Farajkhoda2Department of Midwifery and Reproductive Health, Faculty of Nursing and Midwifery, Reproductive Sciences and Sexual Health Research Center, Isfahan University of Medical Sciences, IsfahanDepartment of Midwifery and Reproductive Health, Faculty of Nursing and Midwifery, Isfahan University of Medical Sciences, IsfahanResearch Center for Nursing and Midwifery Care, Non-Communicable Diseases Research Institute, Department of Midwifery, School of Nursing and Midwifery, Shahid Sadoughi University of Medical Sciences, Yazd Background: The interpretation of Down syndrome screening results in assisted reproductive technology (ART) pregnancies is challenging. Despite the high psychological burden that false positive results impose on parents, studies that have addressed interpretation of both serum and sonographic markers in both rounds of screening for Down syndrome diagnosis in post-ART pregnancies are limited. Objective: This review study investigated the types of serum screening and imaging for prenatal diagnosis of Down syndrome in ART pregnancies to know and correctly interpret the results of prenatal screenings in these pregnancies. Materials and Methods: In this systematic review, an extensive search was conducted in Persian and English in PubMed, Web of Science, Scopus, SID, and Google Scholar without any time limit until January 2024 using appropriate keywords. PRISMA guideline, STROBE, and CONSORT checklists were used. Results: Review of 30 articles showed in the first screening, pregnancy-associated plasma protein-A was significantly lower than normal values compared to spontaneous pregnancies, while free beta-human chorionic gonadotropin, especially in the in vitro fertilization (IVF) and intracytoplasmic sperm injection (ICSI) was significantly higher. Some studies also indicated an increase in nuchal translucency in the first trimester of pregnancies resulting from ART.. Biochemical markers of second screening, in some studies, showed an increase in inhibin-A, a decrease in α-fetoprotein, and unconjugated estriol were evident compared to normal values. Conclusion: Marker levels may be different for the presence of ovulation-stimulating hormones, multiple corpora lutea, twins or multiplets, type of IVF, and changes in egg cytoplasm in ICSI. Study suggests concentration of maternal serum markers, especially free beta-human chorionic gonadotropin and pregnancy-associated plasma protein-A, should be adjusted differently for each ART (IVF and ICSI separately). https://knepublishing.com/index.php/ijrm/article/view/18773Down syndromePrenatal diagnosisMaternal serum screening testsAssisted reproductive technique |
| spellingShingle | Fatemeh Zahra Meamar Mitra Savabi-Esfahani Tahmineh Farajkhoda Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review International Journal of Reproductive BioMedicine Down syndrome Prenatal diagnosis Maternal serum screening tests Assisted reproductive technique |
| title | Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review |
| title_full | Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review |
| title_fullStr | Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review |
| title_full_unstemmed | Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review |
| title_short | Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review |
| title_sort | prenatal screening of down syndrome in assisted reproductive techniques pregnancies a systematic review |
| topic | Down syndrome Prenatal diagnosis Maternal serum screening tests Assisted reproductive technique |
| url | https://knepublishing.com/index.php/ijrm/article/view/18773 |
| work_keys_str_mv | AT fatemehzahrameamar prenatalscreeningofdownsyndromeinassistedreproductivetechniquespregnanciesasystematicreview AT mitrasavabiesfahani prenatalscreeningofdownsyndromeinassistedreproductivetechniquespregnanciesasystematicreview AT tahminehfarajkhoda prenatalscreeningofdownsyndromeinassistedreproductivetechniquespregnanciesasystematicreview |