Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review

Background: The interpretation of Down syndrome screening results in assisted reproductive technology (ART) pregnancies is challenging. Despite the high psychological burden that false positive results impose on parents, studies that have addressed interpretation of both serum and sonographic marke...

Full description

Saved in:
Bibliographic Details
Main Authors: Fatemeh Zahra Meamar, Mitra Savabi-Esfahani, Tahmineh Farajkhoda
Format: Article
Language:English
Published: Shahid Sadoughi University of Medical Sciences 2025-05-01
Series:International Journal of Reproductive BioMedicine
Subjects:
Online Access:https://knepublishing.com/index.php/ijrm/article/view/18773
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1849688181867282432
author Fatemeh Zahra Meamar
Mitra Savabi-Esfahani
Tahmineh Farajkhoda
author_facet Fatemeh Zahra Meamar
Mitra Savabi-Esfahani
Tahmineh Farajkhoda
author_sort Fatemeh Zahra Meamar
collection DOAJ
description Background: The interpretation of Down syndrome screening results in assisted reproductive technology (ART) pregnancies is challenging. Despite the high psychological burden that false positive results impose on parents, studies that have addressed interpretation of both serum and sonographic markers in both rounds of screening for Down syndrome diagnosis in post-ART pregnancies are limited. Objective: This review study investigated the types of serum screening and imaging for prenatal diagnosis of Down syndrome in ART pregnancies to know and correctly interpret the results of prenatal screenings in these pregnancies. Materials and Methods: In this systematic review, an extensive search was conducted in Persian and English in PubMed, Web of Science, Scopus, SID, and Google Scholar without any time limit until January 2024 using appropriate keywords. PRISMA guideline, STROBE, and CONSORT checklists were used. Results: Review of 30 articles showed in the first screening, pregnancy-associated plasma protein-A was significantly lower than normal values compared to spontaneous pregnancies, while free beta-human chorionic gonadotropin, especially in the in vitro fertilization (IVF) and intracytoplasmic sperm injection (ICSI) was significantly higher. Some studies also indicated an increase in nuchal translucency in the first trimester of pregnancies resulting from ART.. Biochemical markers of second screening, in some studies, showed an increase in inhibin-A, a decrease in α-fetoprotein, and unconjugated estriol were evident compared to normal values. Conclusion: Marker levels may be different for the presence of ovulation-stimulating hormones, multiple corpora lutea, twins or multiplets, type of IVF, and changes in egg cytoplasm in ICSI. Study suggests concentration of maternal serum markers, especially free beta-human chorionic gonadotropin and pregnancy-associated plasma protein-A, should be adjusted differently for each ART (IVF and ICSI separately).
format Article
id doaj-art-ced96014a3e2431f930d2e12f3cc2b9b
institution DOAJ
issn 2476-4108
2476-3772
language English
publishDate 2025-05-01
publisher Shahid Sadoughi University of Medical Sciences
record_format Article
series International Journal of Reproductive BioMedicine
spelling doaj-art-ced96014a3e2431f930d2e12f3cc2b9b2025-08-20T03:22:04ZengShahid Sadoughi University of Medical SciencesInternational Journal of Reproductive BioMedicine2476-41082476-37722025-05-0123310.18502/ijrm.v23i3.18773Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic reviewFatemeh Zahra Meamar0Mitra Savabi-Esfahani1Tahmineh Farajkhoda2Department of Midwifery and Reproductive Health, Faculty of Nursing and Midwifery, Reproductive Sciences and Sexual Health Research Center, Isfahan University of Medical Sciences, IsfahanDepartment of Midwifery and Reproductive Health, Faculty of Nursing and Midwifery, Isfahan University of Medical Sciences, IsfahanResearch Center for Nursing and Midwifery Care, Non-Communicable Diseases Research Institute, Department of Midwifery, School of Nursing and Midwifery, Shahid Sadoughi University of Medical Sciences, Yazd Background: The interpretation of Down syndrome screening results in assisted reproductive technology (ART) pregnancies is challenging. Despite the high psychological burden that false positive results impose on parents, studies that have addressed interpretation of both serum and sonographic markers in both rounds of screening for Down syndrome diagnosis in post-ART pregnancies are limited. Objective: This review study investigated the types of serum screening and imaging for prenatal diagnosis of Down syndrome in ART pregnancies to know and correctly interpret the results of prenatal screenings in these pregnancies. Materials and Methods: In this systematic review, an extensive search was conducted in Persian and English in PubMed, Web of Science, Scopus, SID, and Google Scholar without any time limit until January 2024 using appropriate keywords. PRISMA guideline, STROBE, and CONSORT checklists were used. Results: Review of 30 articles showed in the first screening, pregnancy-associated plasma protein-A was significantly lower than normal values compared to spontaneous pregnancies, while free beta-human chorionic gonadotropin, especially in the in vitro fertilization (IVF) and intracytoplasmic sperm injection (ICSI) was significantly higher. Some studies also indicated an increase in nuchal translucency in the first trimester of pregnancies resulting from ART.. Biochemical markers of second screening, in some studies, showed an increase in inhibin-A, a decrease in α-fetoprotein, and unconjugated estriol were evident compared to normal values. Conclusion: Marker levels may be different for the presence of ovulation-stimulating hormones, multiple corpora lutea, twins or multiplets, type of IVF, and changes in egg cytoplasm in ICSI. Study suggests concentration of maternal serum markers, especially free beta-human chorionic gonadotropin and pregnancy-associated plasma protein-A, should be adjusted differently for each ART (IVF and ICSI separately). https://knepublishing.com/index.php/ijrm/article/view/18773Down syndromePrenatal diagnosisMaternal serum screening testsAssisted reproductive technique
spellingShingle Fatemeh Zahra Meamar
Mitra Savabi-Esfahani
Tahmineh Farajkhoda
Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review
International Journal of Reproductive BioMedicine
Down syndrome
Prenatal diagnosis
Maternal serum screening tests
Assisted reproductive technique
title Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review
title_full Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review
title_fullStr Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review
title_full_unstemmed Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review
title_short Prenatal screening of Down syndrome in assisted reproductive techniques pregnancies: A systematic review
title_sort prenatal screening of down syndrome in assisted reproductive techniques pregnancies a systematic review
topic Down syndrome
Prenatal diagnosis
Maternal serum screening tests
Assisted reproductive technique
url https://knepublishing.com/index.php/ijrm/article/view/18773
work_keys_str_mv AT fatemehzahrameamar prenatalscreeningofdownsyndromeinassistedreproductivetechniquespregnanciesasystematicreview
AT mitrasavabiesfahani prenatalscreeningofdownsyndromeinassistedreproductivetechniquespregnanciesasystematicreview
AT tahminehfarajkhoda prenatalscreeningofdownsyndromeinassistedreproductivetechniquespregnanciesasystematicreview