Limited efficacy of cold and heat therapy as adjunctive treatments for local and functional outcomes of Bothrops atrox snakebite envenomation: A randomized clinical trial.

<h4>Background</h4>Bothrops atrox envenomation can cause significant local and systemic effects. Adjunctive therapies, such as cold and heat applications, are proposed to enhance antivenom efficacy, but their clinical value remains unclear.<h4>Methods</h4>This randomized, thr...

Full description

Saved in:
Bibliographic Details
Main Authors: Mailma Costa de Almeida, Kathleen Maclenny Pereira Carvalho, Yasmim da Silva Mendes, Debora Nery Oliveira, Érica da Silva Carvalho, Marco Aurélio Sartim, Felipe Queiroz Araújo, André Sachett, João Ricardo Nickenig Vissoci, Fernando Almeida-Val, Daniel Barros de Castro, Wuelton Monteiro, Jacqueline de Almeida Gonçalves Sachett
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2025-08-01
Series:PLoS Neglected Tropical Diseases
Online Access:https://doi.org/10.1371/journal.pntd.0013423
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1849222422749773824
author Mailma Costa de Almeida
Kathleen Maclenny Pereira Carvalho
Yasmim da Silva Mendes
Debora Nery Oliveira
Érica da Silva Carvalho
Marco Aurélio Sartim
Felipe Queiroz Araújo
André Sachett
João Ricardo Nickenig Vissoci
Fernando Almeida-Val
Daniel Barros de Castro
Wuelton Monteiro
Jacqueline de Almeida Gonçalves Sachett
author_facet Mailma Costa de Almeida
Kathleen Maclenny Pereira Carvalho
Yasmim da Silva Mendes
Debora Nery Oliveira
Érica da Silva Carvalho
Marco Aurélio Sartim
Felipe Queiroz Araújo
André Sachett
João Ricardo Nickenig Vissoci
Fernando Almeida-Val
Daniel Barros de Castro
Wuelton Monteiro
Jacqueline de Almeida Gonçalves Sachett
author_sort Mailma Costa de Almeida
collection DOAJ
description <h4>Background</h4>Bothrops atrox envenomation can cause significant local and systemic effects. Adjunctive therapies, such as cold and heat applications, are proposed to enhance antivenom efficacy, but their clinical value remains unclear.<h4>Methods</h4>This randomized, three-arm clinical trial included 94 patients allocated in a 1:1:1 ratio to Cold Therapy Group (CTG, n = 30), Heat Therapy Group (HTG, n = 31), or Control Group (CG, n = 33). All participants received standard antivenom therapy, with CTG and HTG receiving additional interventions applied for 24 hours post-admission. Primary outcomes included changes in creatine kinase (CK) levels. Secondary outcomes assessed pain intensity, edema, local temperature, and functional recovery using the World Health Organization Disability Assessment Schedule (WHODAS 2.0) assessed four to six months after hospital discharge. Kaplan-Meier survival analysis evaluated time-to-event outcomes.<h4>Findings</h4>Baseline characteristics were comparable across groups. CK levels decreased similarly in all groups at 48 hours (p = 0.89). No significant differences were observed in the reduction of limb circumference, edema extent and bite site temperature, either the ITT or PP analysis. CTG showed a significant reduction in pain within 24 hours in the per-protocol analysis (Log-rank p = 0.04). Disability assessed by WHODAS 2.0 revealed no significant differences between groups after 6 months of follow-up. No adverse events were associated with the interventions.<h4>Interpretation</h4>Adjunctive HTG had no efficacy in treating local effects of B. atrox envenomation. Adjunctive CTG demonstrated benefits observed in pain reduction.
format Article
id doaj-art-ce2309067ece4c51bb51bafb0ba5f5b2
institution Kabale University
issn 1935-2727
1935-2735
language English
publishDate 2025-08-01
publisher Public Library of Science (PLoS)
record_format Article
series PLoS Neglected Tropical Diseases
spelling doaj-art-ce2309067ece4c51bb51bafb0ba5f5b22025-08-26T05:31:11ZengPublic Library of Science (PLoS)PLoS Neglected Tropical Diseases1935-27271935-27352025-08-01198e001342310.1371/journal.pntd.0013423Limited efficacy of cold and heat therapy as adjunctive treatments for local and functional outcomes of Bothrops atrox snakebite envenomation: A randomized clinical trial.Mailma Costa de AlmeidaKathleen Maclenny Pereira CarvalhoYasmim da Silva MendesDebora Nery OliveiraÉrica da Silva CarvalhoMarco Aurélio SartimFelipe Queiroz AraújoAndré SachettJoão Ricardo Nickenig VissociFernando Almeida-ValDaniel Barros de CastroWuelton MonteiroJacqueline de Almeida Gonçalves Sachett<h4>Background</h4>Bothrops atrox envenomation can cause significant local and systemic effects. Adjunctive therapies, such as cold and heat applications, are proposed to enhance antivenom efficacy, but their clinical value remains unclear.<h4>Methods</h4>This randomized, three-arm clinical trial included 94 patients allocated in a 1:1:1 ratio to Cold Therapy Group (CTG, n = 30), Heat Therapy Group (HTG, n = 31), or Control Group (CG, n = 33). All participants received standard antivenom therapy, with CTG and HTG receiving additional interventions applied for 24 hours post-admission. Primary outcomes included changes in creatine kinase (CK) levels. Secondary outcomes assessed pain intensity, edema, local temperature, and functional recovery using the World Health Organization Disability Assessment Schedule (WHODAS 2.0) assessed four to six months after hospital discharge. Kaplan-Meier survival analysis evaluated time-to-event outcomes.<h4>Findings</h4>Baseline characteristics were comparable across groups. CK levels decreased similarly in all groups at 48 hours (p = 0.89). No significant differences were observed in the reduction of limb circumference, edema extent and bite site temperature, either the ITT or PP analysis. CTG showed a significant reduction in pain within 24 hours in the per-protocol analysis (Log-rank p = 0.04). Disability assessed by WHODAS 2.0 revealed no significant differences between groups after 6 months of follow-up. No adverse events were associated with the interventions.<h4>Interpretation</h4>Adjunctive HTG had no efficacy in treating local effects of B. atrox envenomation. Adjunctive CTG demonstrated benefits observed in pain reduction.https://doi.org/10.1371/journal.pntd.0013423
spellingShingle Mailma Costa de Almeida
Kathleen Maclenny Pereira Carvalho
Yasmim da Silva Mendes
Debora Nery Oliveira
Érica da Silva Carvalho
Marco Aurélio Sartim
Felipe Queiroz Araújo
André Sachett
João Ricardo Nickenig Vissoci
Fernando Almeida-Val
Daniel Barros de Castro
Wuelton Monteiro
Jacqueline de Almeida Gonçalves Sachett
Limited efficacy of cold and heat therapy as adjunctive treatments for local and functional outcomes of Bothrops atrox snakebite envenomation: A randomized clinical trial.
PLoS Neglected Tropical Diseases
title Limited efficacy of cold and heat therapy as adjunctive treatments for local and functional outcomes of Bothrops atrox snakebite envenomation: A randomized clinical trial.
title_full Limited efficacy of cold and heat therapy as adjunctive treatments for local and functional outcomes of Bothrops atrox snakebite envenomation: A randomized clinical trial.
title_fullStr Limited efficacy of cold and heat therapy as adjunctive treatments for local and functional outcomes of Bothrops atrox snakebite envenomation: A randomized clinical trial.
title_full_unstemmed Limited efficacy of cold and heat therapy as adjunctive treatments for local and functional outcomes of Bothrops atrox snakebite envenomation: A randomized clinical trial.
title_short Limited efficacy of cold and heat therapy as adjunctive treatments for local and functional outcomes of Bothrops atrox snakebite envenomation: A randomized clinical trial.
title_sort limited efficacy of cold and heat therapy as adjunctive treatments for local and functional outcomes of bothrops atrox snakebite envenomation a randomized clinical trial
url https://doi.org/10.1371/journal.pntd.0013423
work_keys_str_mv AT mailmacostadealmeida limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT kathleenmaclennypereiracarvalho limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT yasmimdasilvamendes limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT deboraneryoliveira limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT ericadasilvacarvalho limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT marcoaureliosartim limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT felipequeirozaraujo limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT andresachett limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT joaoricardonickenigvissoci limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT fernandoalmeidaval limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT danielbarrosdecastro limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT wueltonmonteiro limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial
AT jacquelinedealmeidagoncalvessachett limitedefficacyofcoldandheattherapyasadjunctivetreatmentsforlocalandfunctionaloutcomesofbothropsatroxsnakebiteenvenomationarandomizedclinicaltrial