Modeling Transmission Lines With Open Boundaries via Infinite Mapping Layer
In this paper we introduce the use of several different Infinite Mapping Layers to model open boundaries in the 2-D Finite Element Method for the computation of transmission line parameters. The transformation maps a semi-infinite interval to a finite interval, thereby providing a simple and accurat...
Saved in:
| Main Authors: | , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
IEEE
2024-01-01
|
| Series: | IEEE Journal of Microwaves |
| Subjects: | |
| Online Access: | https://ieeexplore.ieee.org/document/10507887/ |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1841557044577959936 |
|---|---|
| author | Gines Garcia-Contreras Juan Corcoles Jorge A. Ruiz-Cruz Matteo Oldoni Lorenzo Codecasa Gian Guido Gentili |
| author_facet | Gines Garcia-Contreras Juan Corcoles Jorge A. Ruiz-Cruz Matteo Oldoni Lorenzo Codecasa Gian Guido Gentili |
| author_sort | Gines Garcia-Contreras |
| collection | DOAJ |
| description | In this paper we introduce the use of several different Infinite Mapping Layers to model open boundaries in the 2-D Finite Element Method for the computation of transmission line parameters. The transformation maps a semi-infinite interval to a finite interval, thereby providing a simple and accurate description of open boundaries while keeping the size of the computational domain very compact. The method has been evaluated and tested on a variety of common transmission line geometries appearing in the literature and its accuracy is validated by comparing the results with canonical cases having closed expressions and with arbitrary geometries computed with commercial software tools. Various geometrical transformations have been developed and tested, and their performances evaluated in terms of accuracy and efficiency. Finally, the possibility of using a radial Infinite Mapping Layer has also been considered. |
| format | Article |
| id | doaj-art-c7d1518e73dd4e64945ceb1ed50d34db |
| institution | Kabale University |
| issn | 2692-8388 |
| language | English |
| publishDate | 2024-01-01 |
| publisher | IEEE |
| record_format | Article |
| series | IEEE Journal of Microwaves |
| spelling | doaj-art-c7d1518e73dd4e64945ceb1ed50d34db2025-01-07T00:03:08ZengIEEEIEEE Journal of Microwaves2692-83882024-01-014355856710.1109/JMW.2024.338504710507887Modeling Transmission Lines With Open Boundaries via Infinite Mapping LayerGines Garcia-Contreras0https://orcid.org/0000-0001-5784-9409Juan Corcoles1https://orcid.org/0000-0002-9595-3992Jorge A. Ruiz-Cruz2https://orcid.org/0000-0003-3909-8263Matteo Oldoni3https://orcid.org/0000-0002-7804-042XLorenzo Codecasa4https://orcid.org/0000-0002-2851-3698Gian Guido Gentili5https://orcid.org/0000-0001-9533-8458Departamento de Tecnología electrónica y de las Comunicaciones, Escuela Politécnica Superior, Universidad Autónoma de Madrid, Madrid, SpainInformation Processing and Telecommunications Center, Universidad Politécnica de Madrid, Madrid, SpainInformation Processing and Telecommunications Center, Universidad Politécnica de Madrid, Madrid, SpainDipartimento di Elettronica, Informazione e Bioingegneria, Politecnico di Milano, Milan, ItalyDipartimento di Elettronica, Informazione e Bioingegneria, Politecnico di Milano, Milan, ItalyDipartimento di Elettronica, Informazione e Bioingegneria, Politecnico di Milano, Milan, ItalyIn this paper we introduce the use of several different Infinite Mapping Layers to model open boundaries in the 2-D Finite Element Method for the computation of transmission line parameters. The transformation maps a semi-infinite interval to a finite interval, thereby providing a simple and accurate description of open boundaries while keeping the size of the computational domain very compact. The method has been evaluated and tested on a variety of common transmission line geometries appearing in the literature and its accuracy is validated by comparing the results with canonical cases having closed expressions and with arbitrary geometries computed with commercial software tools. Various geometrical transformations have been developed and tested, and their performances evaluated in terms of accuracy and efficiency. Finally, the possibility of using a radial Infinite Mapping Layer has also been considered.https://ieeexplore.ieee.org/document/10507887/Electrostaticsfinite element method (FEM)geometric transformationopen boundariestransformation opticstransmission lines |
| spellingShingle | Gines Garcia-Contreras Juan Corcoles Jorge A. Ruiz-Cruz Matteo Oldoni Lorenzo Codecasa Gian Guido Gentili Modeling Transmission Lines With Open Boundaries via Infinite Mapping Layer IEEE Journal of Microwaves Electrostatics finite element method (FEM) geometric transformation open boundaries transformation optics transmission lines |
| title | Modeling Transmission Lines With Open Boundaries via Infinite Mapping Layer |
| title_full | Modeling Transmission Lines With Open Boundaries via Infinite Mapping Layer |
| title_fullStr | Modeling Transmission Lines With Open Boundaries via Infinite Mapping Layer |
| title_full_unstemmed | Modeling Transmission Lines With Open Boundaries via Infinite Mapping Layer |
| title_short | Modeling Transmission Lines With Open Boundaries via Infinite Mapping Layer |
| title_sort | modeling transmission lines with open boundaries via infinite mapping layer |
| topic | Electrostatics finite element method (FEM) geometric transformation open boundaries transformation optics transmission lines |
| url | https://ieeexplore.ieee.org/document/10507887/ |
| work_keys_str_mv | AT ginesgarciacontreras modelingtransmissionlineswithopenboundariesviainfinitemappinglayer AT juancorcoles modelingtransmissionlineswithopenboundariesviainfinitemappinglayer AT jorgearuizcruz modelingtransmissionlineswithopenboundariesviainfinitemappinglayer AT matteooldoni modelingtransmissionlineswithopenboundariesviainfinitemappinglayer AT lorenzocodecasa modelingtransmissionlineswithopenboundariesviainfinitemappinglayer AT gianguidogentili modelingtransmissionlineswithopenboundariesviainfinitemappinglayer |