Ultrasubwavelength Ferroelectric Leaky Wave Antenna in a Planar Substrate-Superstrate Configuration
The possibility of achieving directive fan-beam radiation with planar Fabry-Pérot cavity antennas constituted by an upper ferroelectric thin film and a lower ground plane having ultrasubwavelength thickness is studied by means of a simple transverse-equivalent-network approach and a cylindrical leak...
Saved in:
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2014-01-01
|
| Series: | International Journal of Antennas and Propagation |
| Online Access: | http://dx.doi.org/10.1155/2014/193690 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832553571074179072 |
|---|---|
| author | G. Lovat P. Burghignoli R. Araneo S. Celozzi |
| author_facet | G. Lovat P. Burghignoli R. Araneo S. Celozzi |
| author_sort | G. Lovat |
| collection | DOAJ |
| description | The possibility of achieving directive fan-beam radiation with planar Fabry-Pérot cavity antennas constituted by an upper ferroelectric thin film and a lower ground plane having ultrasubwavelength thickness is studied by means of a simple transverse-equivalent-network approach and a cylindrical leakywave analysis, deriving simple design formulas. The performance of the proposed antenna is investigated in terms of power density radiated at broadside and directivity in the principal planes, pointing out the main limitations and tradeoffs associated with the reduced thickness. |
| format | Article |
| id | doaj-art-c4f1e44929de4f6dbf16998ed4c4e6be |
| institution | Kabale University |
| issn | 1687-5869 1687-5877 |
| language | English |
| publishDate | 2014-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | International Journal of Antennas and Propagation |
| spelling | doaj-art-c4f1e44929de4f6dbf16998ed4c4e6be2025-02-03T05:53:44ZengWileyInternational Journal of Antennas and Propagation1687-58691687-58772014-01-01201410.1155/2014/193690193690Ultrasubwavelength Ferroelectric Leaky Wave Antenna in a Planar Substrate-Superstrate ConfigurationG. Lovat0P. Burghignoli1R. Araneo2S. Celozzi3Department of Astronautical, Electrical and Energetic Engineering (DIAEE), Sapienza University of Rome, Via Eudossiana 18, 00148 Roma, ItalyDepartment of Information Engineering, Electronics and Telecommunications, Sapienza University of Rome, Via Eudossiana 18, 00148 Roma, ItalyDepartment of Astronautical, Electrical and Energetic Engineering (DIAEE), Sapienza University of Rome, Via Eudossiana 18, 00148 Roma, ItalyDepartment of Astronautical, Electrical and Energetic Engineering (DIAEE), Sapienza University of Rome, Via Eudossiana 18, 00148 Roma, ItalyThe possibility of achieving directive fan-beam radiation with planar Fabry-Pérot cavity antennas constituted by an upper ferroelectric thin film and a lower ground plane having ultrasubwavelength thickness is studied by means of a simple transverse-equivalent-network approach and a cylindrical leakywave analysis, deriving simple design formulas. The performance of the proposed antenna is investigated in terms of power density radiated at broadside and directivity in the principal planes, pointing out the main limitations and tradeoffs associated with the reduced thickness.http://dx.doi.org/10.1155/2014/193690 |
| spellingShingle | G. Lovat P. Burghignoli R. Araneo S. Celozzi Ultrasubwavelength Ferroelectric Leaky Wave Antenna in a Planar Substrate-Superstrate Configuration International Journal of Antennas and Propagation |
| title | Ultrasubwavelength Ferroelectric Leaky Wave Antenna in a Planar Substrate-Superstrate Configuration |
| title_full | Ultrasubwavelength Ferroelectric Leaky Wave Antenna in a Planar Substrate-Superstrate Configuration |
| title_fullStr | Ultrasubwavelength Ferroelectric Leaky Wave Antenna in a Planar Substrate-Superstrate Configuration |
| title_full_unstemmed | Ultrasubwavelength Ferroelectric Leaky Wave Antenna in a Planar Substrate-Superstrate Configuration |
| title_short | Ultrasubwavelength Ferroelectric Leaky Wave Antenna in a Planar Substrate-Superstrate Configuration |
| title_sort | ultrasubwavelength ferroelectric leaky wave antenna in a planar substrate superstrate configuration |
| url | http://dx.doi.org/10.1155/2014/193690 |
| work_keys_str_mv | AT glovat ultrasubwavelengthferroelectricleakywaveantennainaplanarsubstratesuperstrateconfiguration AT pburghignoli ultrasubwavelengthferroelectricleakywaveantennainaplanarsubstratesuperstrateconfiguration AT raraneo ultrasubwavelengthferroelectricleakywaveantennainaplanarsubstratesuperstrateconfiguration AT scelozzi ultrasubwavelengthferroelectricleakywaveantennainaplanarsubstratesuperstrateconfiguration |