Genome-Wide Identification and Expression Analysis of the <i>Shaker</i> K<sup>+</sup> Channel Gene Family in Cassava (<i>Manihot esculenta</i> Crantz) Under Potassium Stress
Shaker K<sup>+</sup> channel proteins are responsible for potassium (K<sup>+</sup>) uptake and transport, playing a critical role in plant growth, development, and adaptation to K<sup>+</sup> deficiency. Cassava, a key tropical root crop, is known for its characte...
Saved in:
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2025-07-01
|
| Series: | Plants |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2223-7747/14/14/2213 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849733120062914560 |
|---|---|
| author | Xianhai Xie Chenyu Lin Feilong Yu Haozheng Li Jin Xiao Mingjuan Zheng Wenquan Wang Xin Guo |
| author_facet | Xianhai Xie Chenyu Lin Feilong Yu Haozheng Li Jin Xiao Mingjuan Zheng Wenquan Wang Xin Guo |
| author_sort | Xianhai Xie |
| collection | DOAJ |
| description | Shaker K<sup>+</sup> channel proteins are responsible for potassium (K<sup>+</sup>) uptake and transport, playing a critical role in plant growth, development, and adaptation to K<sup>+</sup> deficiency. Cassava, a key tropical root crop, is known for its characteristic of resilience to nutrient-poor soil and drought stress. However, the Shaker K<sup>+</sup> channel gene family in cassava has not yet been characterized. In this study, 13 Shaker channel genes were identified from the near telomere-to-telomere (T2T) cassava genome using bioinformatics analysis. Phylogenetic relationships classified these genes into five distinct subfamilies, and all encoded proteins contained the conserved GYGD/GYGE motif typical of Shaker channels. Protein interaction network predictions revealed potential interactions among the Shaker family, as well as with the potassium transporter HAK5. Tissue-specific expression pattern analysis showed that <i>MeGORK</i> and <i>MeAKT1.2</i> were expressed in all tissues. Furthermore, quantitative real-time PCR (qRT-PCR) analysis was conducted to examine the transcriptional levels of <i>Shaker</i> K<sup>+</sup> channel gene family members in the roots and leaves of two cassava germplasms with different low-potassium tolerance after one month of low-potassium treatment. The results revealed that <i>MeAKT1.2</i>, <i>MeAKT2.2</i>, and <i>MeKAT1</i> exhibited distinct expression patterns between the two germplasms, with higher expression levels observed in the potassium-tolerant germplasm. Therefore, these three genes may serve as important candidate genes for potassium stress tolerance in cassava. In summary, this study provides valuable insights into the characteristics and biological functions of the <i>Shaker</i> K<sup>+</sup> channel gene family in cassava and identifies potential candidate genes for breeding or engineering potassium-efficient cassava cultivars. |
| format | Article |
| id | doaj-art-be1445bc63df422f9545b4b300e23ff2 |
| institution | DOAJ |
| issn | 2223-7747 |
| language | English |
| publishDate | 2025-07-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Plants |
| spelling | doaj-art-be1445bc63df422f9545b4b300e23ff22025-08-20T03:08:06ZengMDPI AGPlants2223-77472025-07-011414221310.3390/plants14142213Genome-Wide Identification and Expression Analysis of the <i>Shaker</i> K<sup>+</sup> Channel Gene Family in Cassava (<i>Manihot esculenta</i> Crantz) Under Potassium StressXianhai Xie0Chenyu Lin1Feilong Yu2Haozheng Li3Jin Xiao4Mingjuan Zheng5Wenquan Wang6Xin Guo7School of Tropical Agriculture and Forestry, Hainan University, Haikou 570228, ChinaSchool of Tropical Agriculture and Forestry, Hainan University, Haikou 570228, ChinaSchool of Tropical Agriculture and Forestry, Hainan University, Haikou 570228, ChinaSchool of Tropical Agriculture and Forestry, Hainan University, Haikou 570228, ChinaSchool of Tropical Agriculture and Forestry, Hainan University, Haikou 570228, ChinaSchool of Tropical Agriculture and Forestry, Hainan University, Haikou 570228, ChinaSchool of Tropical Agriculture and Forestry, Hainan University, Haikou 570228, ChinaSchool of Tropical Agriculture and Forestry, Hainan University, Haikou 570228, ChinaShaker K<sup>+</sup> channel proteins are responsible for potassium (K<sup>+</sup>) uptake and transport, playing a critical role in plant growth, development, and adaptation to K<sup>+</sup> deficiency. Cassava, a key tropical root crop, is known for its characteristic of resilience to nutrient-poor soil and drought stress. However, the Shaker K<sup>+</sup> channel gene family in cassava has not yet been characterized. In this study, 13 Shaker channel genes were identified from the near telomere-to-telomere (T2T) cassava genome using bioinformatics analysis. Phylogenetic relationships classified these genes into five distinct subfamilies, and all encoded proteins contained the conserved GYGD/GYGE motif typical of Shaker channels. Protein interaction network predictions revealed potential interactions among the Shaker family, as well as with the potassium transporter HAK5. Tissue-specific expression pattern analysis showed that <i>MeGORK</i> and <i>MeAKT1.2</i> were expressed in all tissues. Furthermore, quantitative real-time PCR (qRT-PCR) analysis was conducted to examine the transcriptional levels of <i>Shaker</i> K<sup>+</sup> channel gene family members in the roots and leaves of two cassava germplasms with different low-potassium tolerance after one month of low-potassium treatment. The results revealed that <i>MeAKT1.2</i>, <i>MeAKT2.2</i>, and <i>MeKAT1</i> exhibited distinct expression patterns between the two germplasms, with higher expression levels observed in the potassium-tolerant germplasm. Therefore, these three genes may serve as important candidate genes for potassium stress tolerance in cassava. In summary, this study provides valuable insights into the characteristics and biological functions of the <i>Shaker</i> K<sup>+</sup> channel gene family in cassava and identifies potential candidate genes for breeding or engineering potassium-efficient cassava cultivars.https://www.mdpi.com/2223-7747/14/14/2213<i>Shaker</i> K<sup>+</sup> channel genecassavapotassium stressexpression patternspotassium utilization |
| spellingShingle | Xianhai Xie Chenyu Lin Feilong Yu Haozheng Li Jin Xiao Mingjuan Zheng Wenquan Wang Xin Guo Genome-Wide Identification and Expression Analysis of the <i>Shaker</i> K<sup>+</sup> Channel Gene Family in Cassava (<i>Manihot esculenta</i> Crantz) Under Potassium Stress Plants <i>Shaker</i> K<sup>+</sup> channel gene cassava potassium stress expression patterns potassium utilization |
| title | Genome-Wide Identification and Expression Analysis of the <i>Shaker</i> K<sup>+</sup> Channel Gene Family in Cassava (<i>Manihot esculenta</i> Crantz) Under Potassium Stress |
| title_full | Genome-Wide Identification and Expression Analysis of the <i>Shaker</i> K<sup>+</sup> Channel Gene Family in Cassava (<i>Manihot esculenta</i> Crantz) Under Potassium Stress |
| title_fullStr | Genome-Wide Identification and Expression Analysis of the <i>Shaker</i> K<sup>+</sup> Channel Gene Family in Cassava (<i>Manihot esculenta</i> Crantz) Under Potassium Stress |
| title_full_unstemmed | Genome-Wide Identification and Expression Analysis of the <i>Shaker</i> K<sup>+</sup> Channel Gene Family in Cassava (<i>Manihot esculenta</i> Crantz) Under Potassium Stress |
| title_short | Genome-Wide Identification and Expression Analysis of the <i>Shaker</i> K<sup>+</sup> Channel Gene Family in Cassava (<i>Manihot esculenta</i> Crantz) Under Potassium Stress |
| title_sort | genome wide identification and expression analysis of the i shaker i k sup sup channel gene family in cassava i manihot esculenta i crantz under potassium stress |
| topic | <i>Shaker</i> K<sup>+</sup> channel gene cassava potassium stress expression patterns potassium utilization |
| url | https://www.mdpi.com/2223-7747/14/14/2213 |
| work_keys_str_mv | AT xianhaixie genomewideidentificationandexpressionanalysisoftheishakeriksupsupchannelgenefamilyincassavaimanihotesculentaicrantzunderpotassiumstress AT chenyulin genomewideidentificationandexpressionanalysisoftheishakeriksupsupchannelgenefamilyincassavaimanihotesculentaicrantzunderpotassiumstress AT feilongyu genomewideidentificationandexpressionanalysisoftheishakeriksupsupchannelgenefamilyincassavaimanihotesculentaicrantzunderpotassiumstress AT haozhengli genomewideidentificationandexpressionanalysisoftheishakeriksupsupchannelgenefamilyincassavaimanihotesculentaicrantzunderpotassiumstress AT jinxiao genomewideidentificationandexpressionanalysisoftheishakeriksupsupchannelgenefamilyincassavaimanihotesculentaicrantzunderpotassiumstress AT mingjuanzheng genomewideidentificationandexpressionanalysisoftheishakeriksupsupchannelgenefamilyincassavaimanihotesculentaicrantzunderpotassiumstress AT wenquanwang genomewideidentificationandexpressionanalysisoftheishakeriksupsupchannelgenefamilyincassavaimanihotesculentaicrantzunderpotassiumstress AT xinguo genomewideidentificationandexpressionanalysisoftheishakeriksupsupchannelgenefamilyincassavaimanihotesculentaicrantzunderpotassiumstress |