Molecular Insights into Outer Dynein Arm Defects in Primary Ciliary Dyskinesia: Involvement of ZMYND10 and GRP78

Background: Primary ciliary dyskinesia (PCD) is a rare genetic disorder characterized by recurrent sinopulmonary infections due to motile cilia defects. The disease is genetically heterogeneous, with abnormalities in structural ciliary proteins. Zinc finger MYND-type containing 10 (ZMYND10) is essen...

Full description

Saved in:
Bibliographic Details
Main Authors: İlker Levent Erdem, Zeynep Bengisu Kaya, Pergin Atilla, Nagehan Emiralioğlu, Cemil Can Eylem, Emirhan Nemutlu, Uğur Özçelik, Halime Nayır Büyükşahin, Ayşenur Daniş, Elif Karakoç
Format: Article
Language:English
Published: MDPI AG 2025-06-01
Series:Cells
Subjects:
Online Access:https://www.mdpi.com/2073-4409/14/12/916
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1849433556939440128
author İlker Levent Erdem
Zeynep Bengisu Kaya
Pergin Atilla
Nagehan Emiralioğlu
Cemil Can Eylem
Emirhan Nemutlu
Uğur Özçelik
Halime Nayır Büyükşahin
Ayşenur Daniş
Elif Karakoç
author_facet İlker Levent Erdem
Zeynep Bengisu Kaya
Pergin Atilla
Nagehan Emiralioğlu
Cemil Can Eylem
Emirhan Nemutlu
Uğur Özçelik
Halime Nayır Büyükşahin
Ayşenur Daniş
Elif Karakoç
author_sort İlker Levent Erdem
collection DOAJ
description Background: Primary ciliary dyskinesia (PCD) is a rare genetic disorder characterized by recurrent sinopulmonary infections due to motile cilia defects. The disease is genetically heterogeneous, with abnormalities in structural ciliary proteins. Zinc finger MYND-type containing 10 (ZMYND10) is essential for the assembly of outer dynein arms (ODA), with chaperones like Glucose-regulated protein 78 (GRP78) facilitating protein folding. This study investigates ZMYND10 and Dynein axonemal heavy chain 5 <i>(DNAH5</i>) mutations in individuals with PCD. Methods: Eight individuals aged 14–22 with clinical PCD symptoms and confirmed <i>DNAH5</i> mutations were included. We analyzed the correlation between <i>DNAH5</i> abnormalities and preassembly/chaperone proteins using immunofluorescence labeling. Nasal swabs were double-labeled (<i>DNAH5</i>–β-tubulin, β-tubulin–ZMYND10, β-tubulin–GRP78) and examined via fluorescence microscopy. Serum metabolomics and proteomics were also assessed. Results: The corrected total cell fluorescence (CTCF) levels of <i>DNAH5</i>, ZMYND10, and GRP78 were significantly different between PCD individuals and controls. Metabolomic analysis showed reduced valine, leucine, and isoleucine biosynthesis, with increased malate and triacylglycerol biosynthesis, malate-aspartate and glycerol phosphate shuttles, and arginine/proline metabolism, suggesting mitochondrial and ER stress. Conclusions: The altered expression of DNAH5, ZMYND10, and GRP78, along with metabolic shifts, points to a complex link between ciliary dysfunction and cellular stress in PCD. Further studies are needed to clarify the underlying mechanisms.
format Article
id doaj-art-ba9decc187fb42b0b650826ea4a5ef86
institution Kabale University
issn 2073-4409
language English
publishDate 2025-06-01
publisher MDPI AG
record_format Article
series Cells
spelling doaj-art-ba9decc187fb42b0b650826ea4a5ef862025-08-20T03:27:00ZengMDPI AGCells2073-44092025-06-01141291610.3390/cells14120916Molecular Insights into Outer Dynein Arm Defects in Primary Ciliary Dyskinesia: Involvement of ZMYND10 and GRP78İlker Levent Erdem0Zeynep Bengisu Kaya1Pergin Atilla2Nagehan Emiralioğlu3Cemil Can Eylem4Emirhan Nemutlu5Uğur Özçelik6Halime Nayır Büyükşahin7Ayşenur Daniş8Elif Karakoç9Department of Histology and Embryology, Hacettepe University Faculty of Medicine, 06230 Ankara, TurkeyDepartment of Neuroscience, Mayo Clinic, Jacksonville, FL 32224, USADepartment of Histology and Embryology, Hacettepe University Faculty of Medicine, 06230 Ankara, TurkeyDepartment of Pediatric Pulmonology, Hacettepe University Faculty of Medicine, 06230 Ankara, TurkeyDepartment of Analytical Chemistry, Faculty of Pharmacy, Hacettepe University, 06230 Ankara, TurkeyDepartment of Analytical Chemistry, Faculty of Pharmacy, Hacettepe University, 06230 Ankara, TurkeyDepartment of Pediatric Pulmonology, Hacettepe University Faculty of Medicine, 06230 Ankara, TurkeyDepartment of Pediatric Pulmonology, Hacettepe University Faculty of Medicine, 06230 Ankara, TurkeyDepartment of Pediatrics, University at Buffalo, Buffalo, NY 14203, USADepartment of Histology and Embryology, Hacettepe University Faculty of Medicine, 06230 Ankara, TurkeyBackground: Primary ciliary dyskinesia (PCD) is a rare genetic disorder characterized by recurrent sinopulmonary infections due to motile cilia defects. The disease is genetically heterogeneous, with abnormalities in structural ciliary proteins. Zinc finger MYND-type containing 10 (ZMYND10) is essential for the assembly of outer dynein arms (ODA), with chaperones like Glucose-regulated protein 78 (GRP78) facilitating protein folding. This study investigates ZMYND10 and Dynein axonemal heavy chain 5 <i>(DNAH5</i>) mutations in individuals with PCD. Methods: Eight individuals aged 14–22 with clinical PCD symptoms and confirmed <i>DNAH5</i> mutations were included. We analyzed the correlation between <i>DNAH5</i> abnormalities and preassembly/chaperone proteins using immunofluorescence labeling. Nasal swabs were double-labeled (<i>DNAH5</i>–β-tubulin, β-tubulin–ZMYND10, β-tubulin–GRP78) and examined via fluorescence microscopy. Serum metabolomics and proteomics were also assessed. Results: The corrected total cell fluorescence (CTCF) levels of <i>DNAH5</i>, ZMYND10, and GRP78 were significantly different between PCD individuals and controls. Metabolomic analysis showed reduced valine, leucine, and isoleucine biosynthesis, with increased malate and triacylglycerol biosynthesis, malate-aspartate and glycerol phosphate shuttles, and arginine/proline metabolism, suggesting mitochondrial and ER stress. Conclusions: The altered expression of DNAH5, ZMYND10, and GRP78, along with metabolic shifts, points to a complex link between ciliary dysfunction and cellular stress in PCD. Further studies are needed to clarify the underlying mechanisms.https://www.mdpi.com/2073-4409/14/12/916PCDciliopathyODADNAH5ZMYND10GRP78
spellingShingle İlker Levent Erdem
Zeynep Bengisu Kaya
Pergin Atilla
Nagehan Emiralioğlu
Cemil Can Eylem
Emirhan Nemutlu
Uğur Özçelik
Halime Nayır Büyükşahin
Ayşenur Daniş
Elif Karakoç
Molecular Insights into Outer Dynein Arm Defects in Primary Ciliary Dyskinesia: Involvement of ZMYND10 and GRP78
Cells
PCD
ciliopathy
ODA
DNAH5
ZMYND10
GRP78
title Molecular Insights into Outer Dynein Arm Defects in Primary Ciliary Dyskinesia: Involvement of ZMYND10 and GRP78
title_full Molecular Insights into Outer Dynein Arm Defects in Primary Ciliary Dyskinesia: Involvement of ZMYND10 and GRP78
title_fullStr Molecular Insights into Outer Dynein Arm Defects in Primary Ciliary Dyskinesia: Involvement of ZMYND10 and GRP78
title_full_unstemmed Molecular Insights into Outer Dynein Arm Defects in Primary Ciliary Dyskinesia: Involvement of ZMYND10 and GRP78
title_short Molecular Insights into Outer Dynein Arm Defects in Primary Ciliary Dyskinesia: Involvement of ZMYND10 and GRP78
title_sort molecular insights into outer dynein arm defects in primary ciliary dyskinesia involvement of zmynd10 and grp78
topic PCD
ciliopathy
ODA
DNAH5
ZMYND10
GRP78
url https://www.mdpi.com/2073-4409/14/12/916
work_keys_str_mv AT ilkerleventerdem molecularinsightsintoouterdyneinarmdefectsinprimaryciliarydyskinesiainvolvementofzmynd10andgrp78
AT zeynepbengisukaya molecularinsightsintoouterdyneinarmdefectsinprimaryciliarydyskinesiainvolvementofzmynd10andgrp78
AT perginatilla molecularinsightsintoouterdyneinarmdefectsinprimaryciliarydyskinesiainvolvementofzmynd10andgrp78
AT nagehanemiralioglu molecularinsightsintoouterdyneinarmdefectsinprimaryciliarydyskinesiainvolvementofzmynd10andgrp78
AT cemilcaneylem molecularinsightsintoouterdyneinarmdefectsinprimaryciliarydyskinesiainvolvementofzmynd10andgrp78
AT emirhannemutlu molecularinsightsintoouterdyneinarmdefectsinprimaryciliarydyskinesiainvolvementofzmynd10andgrp78
AT ugurozcelik molecularinsightsintoouterdyneinarmdefectsinprimaryciliarydyskinesiainvolvementofzmynd10andgrp78
AT halimenayırbuyuksahin molecularinsightsintoouterdyneinarmdefectsinprimaryciliarydyskinesiainvolvementofzmynd10andgrp78
AT aysenurdanis molecularinsightsintoouterdyneinarmdefectsinprimaryciliarydyskinesiainvolvementofzmynd10andgrp78
AT elifkarakoc molecularinsightsintoouterdyneinarmdefectsinprimaryciliarydyskinesiainvolvementofzmynd10andgrp78