On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces

Using the critical point theory, we establish sufficient conditions on the existence of ground states for discrete p(k)-Laplacian systems. Our results considerably generalize some existing ones.

Saved in:
Bibliographic Details
Main Author: Juhong Kuang
Format: Article
Language:English
Published: Wiley 2014-01-01
Series:Abstract and Applied Analysis
Online Access:http://dx.doi.org/10.1155/2014/808102
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850176766788763648
author Juhong Kuang
author_facet Juhong Kuang
author_sort Juhong Kuang
collection DOAJ
description Using the critical point theory, we establish sufficient conditions on the existence of ground states for discrete p(k)-Laplacian systems. Our results considerably generalize some existing ones.
format Article
id doaj-art-b8e415ac0d484d25bc8b01f2c9c0fb26
institution OA Journals
issn 1085-3375
1687-0409
language English
publishDate 2014-01-01
publisher Wiley
record_format Article
series Abstract and Applied Analysis
spelling doaj-art-b8e415ac0d484d25bc8b01f2c9c0fb262025-08-20T02:19:11ZengWileyAbstract and Applied Analysis1085-33751687-04092014-01-01201410.1155/2014/808102808102On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence SpacesJuhong Kuang0School of Mathematics and Computational Sciences, Wuyi University, Jiangmen 529020, ChinaUsing the critical point theory, we establish sufficient conditions on the existence of ground states for discrete p(k)-Laplacian systems. Our results considerably generalize some existing ones.http://dx.doi.org/10.1155/2014/808102
spellingShingle Juhong Kuang
On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces
Abstract and Applied Analysis
title On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces
title_full On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces
title_fullStr On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces
title_full_unstemmed On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces
title_short On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces
title_sort on ground states of discrete p k laplacian systems in generalized orlicz sequence spaces
url http://dx.doi.org/10.1155/2014/808102
work_keys_str_mv AT juhongkuang ongroundstatesofdiscretepklaplaciansystemsingeneralizedorliczsequencespaces