On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces
Using the critical point theory, we establish sufficient conditions on the existence of ground states for discrete p(k)-Laplacian systems. Our results considerably generalize some existing ones.
Saved in:
| Main Author: | |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2014-01-01
|
| Series: | Abstract and Applied Analysis |
| Online Access: | http://dx.doi.org/10.1155/2014/808102 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850176766788763648 |
|---|---|
| author | Juhong Kuang |
| author_facet | Juhong Kuang |
| author_sort | Juhong Kuang |
| collection | DOAJ |
| description | Using the critical point theory, we establish sufficient conditions on the existence of ground states for discrete p(k)-Laplacian systems. Our results considerably generalize some existing ones. |
| format | Article |
| id | doaj-art-b8e415ac0d484d25bc8b01f2c9c0fb26 |
| institution | OA Journals |
| issn | 1085-3375 1687-0409 |
| language | English |
| publishDate | 2014-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | Abstract and Applied Analysis |
| spelling | doaj-art-b8e415ac0d484d25bc8b01f2c9c0fb262025-08-20T02:19:11ZengWileyAbstract and Applied Analysis1085-33751687-04092014-01-01201410.1155/2014/808102808102On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence SpacesJuhong Kuang0School of Mathematics and Computational Sciences, Wuyi University, Jiangmen 529020, ChinaUsing the critical point theory, we establish sufficient conditions on the existence of ground states for discrete p(k)-Laplacian systems. Our results considerably generalize some existing ones.http://dx.doi.org/10.1155/2014/808102 |
| spellingShingle | Juhong Kuang On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces Abstract and Applied Analysis |
| title | On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces |
| title_full | On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces |
| title_fullStr | On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces |
| title_full_unstemmed | On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces |
| title_short | On Ground States of Discrete p(k)-Laplacian Systems in Generalized Orlicz Sequence Spaces |
| title_sort | on ground states of discrete p k laplacian systems in generalized orlicz sequence spaces |
| url | http://dx.doi.org/10.1155/2014/808102 |
| work_keys_str_mv | AT juhongkuang ongroundstatesofdiscretepklaplaciansystemsingeneralizedorliczsequencespaces |