Biochemical Pattern of Methylmalonyl-CoA Epimerase Deficiency Identified in Newborn Screening: A Case Report

Methylmalonyl-CoA epimerase enzyme (MCEE) is responsible for catalyzing the isomeric conversion between D- and L-methylmalonyl-CoA, an intermediate along the conversion of propionyl-CoA to succinyl-CoA. A dedicated test for MCEE deficiency is not included in the newborn screening (NBS) panels but it...

Full description

Saved in:
Bibliographic Details
Main Authors: Evelina Maines, Roberto Franceschi, Francesca Rivieri, Giovanni Piccoli, Björn Schulte, Jessica Hoffmann, Andrea Bordugo, Giulia Rodella, Francesca Teofoli, Monica Vincenzi, Massimo Soffiati, Marta Camilot
Format: Article
Language:English
Published: MDPI AG 2024-07-01
Series:International Journal of Neonatal Screening
Subjects:
Online Access:https://www.mdpi.com/2409-515X/10/3/53
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1825202090519035904
author Evelina Maines
Roberto Franceschi
Francesca Rivieri
Giovanni Piccoli
Björn Schulte
Jessica Hoffmann
Andrea Bordugo
Giulia Rodella
Francesca Teofoli
Monica Vincenzi
Massimo Soffiati
Marta Camilot
author_facet Evelina Maines
Roberto Franceschi
Francesca Rivieri
Giovanni Piccoli
Björn Schulte
Jessica Hoffmann
Andrea Bordugo
Giulia Rodella
Francesca Teofoli
Monica Vincenzi
Massimo Soffiati
Marta Camilot
author_sort Evelina Maines
collection DOAJ
description Methylmalonyl-CoA epimerase enzyme (MCEE) is responsible for catalyzing the isomeric conversion between D- and L-methylmalonyl-CoA, an intermediate along the conversion of propionyl-CoA to succinyl-CoA. A dedicated test for MCEE deficiency is not included in the newborn screening (NBS) panels but it can be incidentally identified when investigating methylmalonic acidemia and propionic acidemia. Here, we report for the first time the biochemical description of a case detected by NBS. The NBS results showed increased levels of propionylcarnitine (C3) and 2-methylcitric acid (MCA), while methylmalonic acid (MMA) and homocysteine (Hcy) were within the reference limits. Confirmatory analyses revealed altered levels of metabolites, including MCA and MMA, suggesting a block in the propionate degradation pathway. The analysis of methylmalonic pathway genes by next-generation sequencing (NGS) allowed the identification of the known homozygous nonsense variation c.139C>T (p.R47X) in exon 2 of the MCE gene. Conclusions: Elevated concentrations of C3 with a slight increase in MCA and normal MMA and Hcy during NBS should prompt the consideration of MCEE deficiency in differential diagnosis. Increased MMA levels may be negligible at NBS as they may reach relevant values beyond the first days of life and thus could be identified only in confirmatory analyses.
format Article
id doaj-art-b60cffae35ee45fc8e6900dc66977123
institution Kabale University
issn 2409-515X
language English
publishDate 2024-07-01
publisher MDPI AG
record_format Article
series International Journal of Neonatal Screening
spelling doaj-art-b60cffae35ee45fc8e6900dc669771232025-02-07T14:48:36ZengMDPI AGInternational Journal of Neonatal Screening2409-515X2024-07-011035310.3390/ijns10030053Biochemical Pattern of Methylmalonyl-CoA Epimerase Deficiency Identified in Newborn Screening: A Case ReportEvelina Maines0Roberto Franceschi1Francesca Rivieri2Giovanni Piccoli3Björn Schulte4Jessica Hoffmann5Andrea Bordugo6Giulia Rodella7Francesca Teofoli8Monica Vincenzi9Massimo Soffiati10Marta Camilot11Division of Pediatrics, Santa Chiara General Hospital, APSS Trento, 38122 Trento, ItalyDivision of Pediatrics, Santa Chiara General Hospital, APSS Trento, 38122 Trento, ItalyGenetic Unit, Laboratory of Clinical Pathology, Department of Laboratories, APSS Trento, 38122 Trento, ItalyCIBIO—Department of Cellular, Computational and Integrative Biology, Università degli Studi di Trento, 38122 Trento, ItalyCeGaT GmbH Tuebingen, 72076 Tuebingen, GermanyCeGaT GmbH Tuebingen, 72076 Tuebingen, GermanyInherited Metabolic Disease Unit, Pediatric Department, AOUI Verona, 37134 Verona, ItalyInherited Metabolic Disease Unit, Pediatric Department, AOUI Verona, 37134 Verona, ItalyDepartment of Mother and Child, The Regional Center for Neonatal Screening, Diagnosis and Treatment of Inherited Congenital Metabolic and Endocrinological Diseases, AOUI Verona, 37134 Verona, ItalyDepartment of Mother and Child, The Regional Center for Neonatal Screening, Diagnosis and Treatment of Inherited Congenital Metabolic and Endocrinological Diseases, AOUI Verona, 37134 Verona, ItalyDivision of Pediatrics, Santa Chiara General Hospital, APSS Trento, 38122 Trento, ItalyDepartment of Mother and Child, The Regional Center for Neonatal Screening, Diagnosis and Treatment of Inherited Congenital Metabolic and Endocrinological Diseases, AOUI Verona, 37134 Verona, ItalyMethylmalonyl-CoA epimerase enzyme (MCEE) is responsible for catalyzing the isomeric conversion between D- and L-methylmalonyl-CoA, an intermediate along the conversion of propionyl-CoA to succinyl-CoA. A dedicated test for MCEE deficiency is not included in the newborn screening (NBS) panels but it can be incidentally identified when investigating methylmalonic acidemia and propionic acidemia. Here, we report for the first time the biochemical description of a case detected by NBS. The NBS results showed increased levels of propionylcarnitine (C3) and 2-methylcitric acid (MCA), while methylmalonic acid (MMA) and homocysteine (Hcy) were within the reference limits. Confirmatory analyses revealed altered levels of metabolites, including MCA and MMA, suggesting a block in the propionate degradation pathway. The analysis of methylmalonic pathway genes by next-generation sequencing (NGS) allowed the identification of the known homozygous nonsense variation c.139C>T (p.R47X) in exon 2 of the MCE gene. Conclusions: Elevated concentrations of C3 with a slight increase in MCA and normal MMA and Hcy during NBS should prompt the consideration of MCEE deficiency in differential diagnosis. Increased MMA levels may be negligible at NBS as they may reach relevant values beyond the first days of life and thus could be identified only in confirmatory analyses.https://www.mdpi.com/2409-515X/10/3/53methylmalonyl CoA epimerase deficiencynewborn screeningcase report
spellingShingle Evelina Maines
Roberto Franceschi
Francesca Rivieri
Giovanni Piccoli
Björn Schulte
Jessica Hoffmann
Andrea Bordugo
Giulia Rodella
Francesca Teofoli
Monica Vincenzi
Massimo Soffiati
Marta Camilot
Biochemical Pattern of Methylmalonyl-CoA Epimerase Deficiency Identified in Newborn Screening: A Case Report
International Journal of Neonatal Screening
methylmalonyl CoA epimerase deficiency
newborn screening
case report
title Biochemical Pattern of Methylmalonyl-CoA Epimerase Deficiency Identified in Newborn Screening: A Case Report
title_full Biochemical Pattern of Methylmalonyl-CoA Epimerase Deficiency Identified in Newborn Screening: A Case Report
title_fullStr Biochemical Pattern of Methylmalonyl-CoA Epimerase Deficiency Identified in Newborn Screening: A Case Report
title_full_unstemmed Biochemical Pattern of Methylmalonyl-CoA Epimerase Deficiency Identified in Newborn Screening: A Case Report
title_short Biochemical Pattern of Methylmalonyl-CoA Epimerase Deficiency Identified in Newborn Screening: A Case Report
title_sort biochemical pattern of methylmalonyl coa epimerase deficiency identified in newborn screening a case report
topic methylmalonyl CoA epimerase deficiency
newborn screening
case report
url https://www.mdpi.com/2409-515X/10/3/53
work_keys_str_mv AT evelinamaines biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT robertofranceschi biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT francescarivieri biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT giovannipiccoli biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT bjornschulte biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT jessicahoffmann biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT andreabordugo biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT giuliarodella biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT francescateofoli biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT monicavincenzi biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT massimosoffiati biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport
AT martacamilot biochemicalpatternofmethylmalonylcoaepimerasedeficiencyidentifiedinnewbornscreeningacasereport