The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review

Chronic kidney disease (CKD) patients often suffer from complications such as anemia as the kidney function declines. More than 25% of CKD hemodialysis patients in China are complicated with renal anemia due to renal and hepatic impairment in the production of erythropoietin (EPO). In recent years,...

Full description

Saved in:
Bibliographic Details
Main Authors: Yousuf Abdulkarim Waheed, Jie Liu, Shifaa Almayahe, Dong Sun
Format: Article
Language:English
Published: Frontiers Media S.A. 2024-12-01
Series:Frontiers in Nephrology
Subjects:
Online Access:https://www.frontiersin.org/articles/10.3389/fneph.2024.1511596/full
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850252238774075392
author Yousuf Abdulkarim Waheed
Yousuf Abdulkarim Waheed
Jie Liu
Shifaa Almayahe
Dong Sun
Dong Sun
Dong Sun
author_facet Yousuf Abdulkarim Waheed
Yousuf Abdulkarim Waheed
Jie Liu
Shifaa Almayahe
Dong Sun
Dong Sun
Dong Sun
author_sort Yousuf Abdulkarim Waheed
collection DOAJ
description Chronic kidney disease (CKD) patients often suffer from complications such as anemia as the kidney function declines. More than 25% of CKD hemodialysis patients in China are complicated with renal anemia due to renal and hepatic impairment in the production of erythropoietin (EPO). In recent years, prolyl hydroxylase domain (PHD) inhibitors have been approved in China and Japan for the treatment of CKD patients complicated with anemia. Daprodustat is a novel orally administrated active hypoxia-induced factor-prolyl hydroxylase inhibitor (HIF-PHI) that may improve quality of life and ischemic conditions such as peripheral arterial disease (PAD), stimulate the synthesis of endogenous EPO, and can effectively induce the production of red blood cells. It has been shown to increase EPO levels, which can lead to an increase in hemoglobin (Hgb), hematocrit, and red blood cell counts. Clinical studies have shown its effectiveness in dialysis and non-dialysis CKD anemic patients. In this literature review, we will focus on the mechanism and metabolism of the drug as well as its clinical applications in dialysis and non-dialysis CKD patients and summarize the adverse reactions.
format Article
id doaj-art-b58cff2bcf02464096dcfc43f00469f5
institution OA Journals
issn 2813-0626
language English
publishDate 2024-12-01
publisher Frontiers Media S.A.
record_format Article
series Frontiers in Nephrology
spelling doaj-art-b58cff2bcf02464096dcfc43f00469f52025-08-20T01:57:41ZengFrontiers Media S.A.Frontiers in Nephrology2813-06262024-12-01410.3389/fneph.2024.15115961511596The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general reviewYousuf Abdulkarim Waheed0Yousuf Abdulkarim Waheed1Jie Liu2Shifaa Almayahe3Dong Sun4Dong Sun5Dong Sun6Department of Nephrology, Affiliated Hospital of Xuzhou Medical University, Xuzhou, ChinaClinical Research Center for Kidney Disease, Xuzhou Medical University, Xuzhou, ChinaDepartment of Nephrology, The Second Affiliated Hospital of Xuzhou Medical University, Xuzhou, ChinaMedical College, University of Fallujah, Al Anbar, IraqDepartment of Nephrology, Affiliated Hospital of Xuzhou Medical University, Xuzhou, ChinaClinical Research Center for Kidney Disease, Xuzhou Medical University, Xuzhou, ChinaDepartment of Internal Medicine and Diagnostics, Xuzhou Medical University, Xuzhou, ChinaChronic kidney disease (CKD) patients often suffer from complications such as anemia as the kidney function declines. More than 25% of CKD hemodialysis patients in China are complicated with renal anemia due to renal and hepatic impairment in the production of erythropoietin (EPO). In recent years, prolyl hydroxylase domain (PHD) inhibitors have been approved in China and Japan for the treatment of CKD patients complicated with anemia. Daprodustat is a novel orally administrated active hypoxia-induced factor-prolyl hydroxylase inhibitor (HIF-PHI) that may improve quality of life and ischemic conditions such as peripheral arterial disease (PAD), stimulate the synthesis of endogenous EPO, and can effectively induce the production of red blood cells. It has been shown to increase EPO levels, which can lead to an increase in hemoglobin (Hgb), hematocrit, and red blood cell counts. Clinical studies have shown its effectiveness in dialysis and non-dialysis CKD anemic patients. In this literature review, we will focus on the mechanism and metabolism of the drug as well as its clinical applications in dialysis and non-dialysis CKD patients and summarize the adverse reactions.https://www.frontiersin.org/articles/10.3389/fneph.2024.1511596/fulldaprodustatanemiachronic kidney diseaseerythropoietindialysishypoxia-induced factor-prolyl hydroxylase inhibitor
spellingShingle Yousuf Abdulkarim Waheed
Yousuf Abdulkarim Waheed
Jie Liu
Shifaa Almayahe
Dong Sun
Dong Sun
Dong Sun
The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review
Frontiers in Nephrology
daprodustat
anemia
chronic kidney disease
erythropoietin
dialysis
hypoxia-induced factor-prolyl hydroxylase inhibitor
title The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review
title_full The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review
title_fullStr The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review
title_full_unstemmed The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review
title_short The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review
title_sort role and clinical implications of hif phi daprodustat in dialysis dependent and non dialysis dependent chronic kidney disease anemic patients a general review
topic daprodustat
anemia
chronic kidney disease
erythropoietin
dialysis
hypoxia-induced factor-prolyl hydroxylase inhibitor
url https://www.frontiersin.org/articles/10.3389/fneph.2024.1511596/full
work_keys_str_mv AT yousufabdulkarimwaheed theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT yousufabdulkarimwaheed theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT jieliu theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT shifaaalmayahe theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT dongsun theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT dongsun theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT dongsun theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT yousufabdulkarimwaheed roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT yousufabdulkarimwaheed roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT jieliu roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT shifaaalmayahe roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT dongsun roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT dongsun roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview
AT dongsun roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview