The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review
Chronic kidney disease (CKD) patients often suffer from complications such as anemia as the kidney function declines. More than 25% of CKD hemodialysis patients in China are complicated with renal anemia due to renal and hepatic impairment in the production of erythropoietin (EPO). In recent years,...
Saved in:
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Frontiers Media S.A.
2024-12-01
|
| Series: | Frontiers in Nephrology |
| Subjects: | |
| Online Access: | https://www.frontiersin.org/articles/10.3389/fneph.2024.1511596/full |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850252238774075392 |
|---|---|
| author | Yousuf Abdulkarim Waheed Yousuf Abdulkarim Waheed Jie Liu Shifaa Almayahe Dong Sun Dong Sun Dong Sun |
| author_facet | Yousuf Abdulkarim Waheed Yousuf Abdulkarim Waheed Jie Liu Shifaa Almayahe Dong Sun Dong Sun Dong Sun |
| author_sort | Yousuf Abdulkarim Waheed |
| collection | DOAJ |
| description | Chronic kidney disease (CKD) patients often suffer from complications such as anemia as the kidney function declines. More than 25% of CKD hemodialysis patients in China are complicated with renal anemia due to renal and hepatic impairment in the production of erythropoietin (EPO). In recent years, prolyl hydroxylase domain (PHD) inhibitors have been approved in China and Japan for the treatment of CKD patients complicated with anemia. Daprodustat is a novel orally administrated active hypoxia-induced factor-prolyl hydroxylase inhibitor (HIF-PHI) that may improve quality of life and ischemic conditions such as peripheral arterial disease (PAD), stimulate the synthesis of endogenous EPO, and can effectively induce the production of red blood cells. It has been shown to increase EPO levels, which can lead to an increase in hemoglobin (Hgb), hematocrit, and red blood cell counts. Clinical studies have shown its effectiveness in dialysis and non-dialysis CKD anemic patients. In this literature review, we will focus on the mechanism and metabolism of the drug as well as its clinical applications in dialysis and non-dialysis CKD patients and summarize the adverse reactions. |
| format | Article |
| id | doaj-art-b58cff2bcf02464096dcfc43f00469f5 |
| institution | OA Journals |
| issn | 2813-0626 |
| language | English |
| publishDate | 2024-12-01 |
| publisher | Frontiers Media S.A. |
| record_format | Article |
| series | Frontiers in Nephrology |
| spelling | doaj-art-b58cff2bcf02464096dcfc43f00469f52025-08-20T01:57:41ZengFrontiers Media S.A.Frontiers in Nephrology2813-06262024-12-01410.3389/fneph.2024.15115961511596The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general reviewYousuf Abdulkarim Waheed0Yousuf Abdulkarim Waheed1Jie Liu2Shifaa Almayahe3Dong Sun4Dong Sun5Dong Sun6Department of Nephrology, Affiliated Hospital of Xuzhou Medical University, Xuzhou, ChinaClinical Research Center for Kidney Disease, Xuzhou Medical University, Xuzhou, ChinaDepartment of Nephrology, The Second Affiliated Hospital of Xuzhou Medical University, Xuzhou, ChinaMedical College, University of Fallujah, Al Anbar, IraqDepartment of Nephrology, Affiliated Hospital of Xuzhou Medical University, Xuzhou, ChinaClinical Research Center for Kidney Disease, Xuzhou Medical University, Xuzhou, ChinaDepartment of Internal Medicine and Diagnostics, Xuzhou Medical University, Xuzhou, ChinaChronic kidney disease (CKD) patients often suffer from complications such as anemia as the kidney function declines. More than 25% of CKD hemodialysis patients in China are complicated with renal anemia due to renal and hepatic impairment in the production of erythropoietin (EPO). In recent years, prolyl hydroxylase domain (PHD) inhibitors have been approved in China and Japan for the treatment of CKD patients complicated with anemia. Daprodustat is a novel orally administrated active hypoxia-induced factor-prolyl hydroxylase inhibitor (HIF-PHI) that may improve quality of life and ischemic conditions such as peripheral arterial disease (PAD), stimulate the synthesis of endogenous EPO, and can effectively induce the production of red blood cells. It has been shown to increase EPO levels, which can lead to an increase in hemoglobin (Hgb), hematocrit, and red blood cell counts. Clinical studies have shown its effectiveness in dialysis and non-dialysis CKD anemic patients. In this literature review, we will focus on the mechanism and metabolism of the drug as well as its clinical applications in dialysis and non-dialysis CKD patients and summarize the adverse reactions.https://www.frontiersin.org/articles/10.3389/fneph.2024.1511596/fulldaprodustatanemiachronic kidney diseaseerythropoietindialysishypoxia-induced factor-prolyl hydroxylase inhibitor |
| spellingShingle | Yousuf Abdulkarim Waheed Yousuf Abdulkarim Waheed Jie Liu Shifaa Almayahe Dong Sun Dong Sun Dong Sun The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review Frontiers in Nephrology daprodustat anemia chronic kidney disease erythropoietin dialysis hypoxia-induced factor-prolyl hydroxylase inhibitor |
| title | The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review |
| title_full | The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review |
| title_fullStr | The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review |
| title_full_unstemmed | The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review |
| title_short | The role and clinical implications of HIF-PHI daprodustat in dialysis-dependent and non-dialysis-dependent chronic kidney disease anemic patients: a general review |
| title_sort | role and clinical implications of hif phi daprodustat in dialysis dependent and non dialysis dependent chronic kidney disease anemic patients a general review |
| topic | daprodustat anemia chronic kidney disease erythropoietin dialysis hypoxia-induced factor-prolyl hydroxylase inhibitor |
| url | https://www.frontiersin.org/articles/10.3389/fneph.2024.1511596/full |
| work_keys_str_mv | AT yousufabdulkarimwaheed theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT yousufabdulkarimwaheed theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT jieliu theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT shifaaalmayahe theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT dongsun theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT dongsun theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT dongsun theroleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT yousufabdulkarimwaheed roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT yousufabdulkarimwaheed roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT jieliu roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT shifaaalmayahe roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT dongsun roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT dongsun roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview AT dongsun roleandclinicalimplicationsofhifphidaprodustatindialysisdependentandnondialysisdependentchronickidneydiseaseanemicpatientsageneralreview |