Relación entre el tipo de ejercicio físico y la fatiga cuantificada mediante VFC, CK y el lactato en sangre (Relationship between physical exercise type and fatigue quantified through HRV, CK, and blood lactate)

  Los atletas son expuestos a cargas de alta intensidad en la búsqueda del rendimiento deportivo, sin embargo, sus efectos no se evalúan apropiadamente. El presente estudio analiza los efectos de cuatro diferentes tipos de ejercicios sobre la variabilidad de la frecuencia cardíaca (VFC), diagram...

Full description

Saved in:
Bibliographic Details
Main Authors: German Hernández-Cruz, Edson Francisco Estrada-Meneses, Arnulfo Ramos-Jiménez, Blanca Rocío Rangel-Colmenero, Luis Felipe Reynoso-Sánchez, Janeth Miranda-Mendoza, José Trinidad Quezada-Chacón
Format: Article
Language:English
Published: FEADEF 2022-04-01
Series:Retos: Nuevas Tendencias en Educación Física, Deportes y Recreación
Subjects:
Online Access:https://recyt.fecyt.es/index.php/retos/article/view/89479
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850120987298758656
author German Hernández-Cruz
Edson Francisco Estrada-Meneses
Arnulfo Ramos-Jiménez
Blanca Rocío Rangel-Colmenero
Luis Felipe Reynoso-Sánchez
Janeth Miranda-Mendoza
José Trinidad Quezada-Chacón
author_facet German Hernández-Cruz
Edson Francisco Estrada-Meneses
Arnulfo Ramos-Jiménez
Blanca Rocío Rangel-Colmenero
Luis Felipe Reynoso-Sánchez
Janeth Miranda-Mendoza
José Trinidad Quezada-Chacón
author_sort German Hernández-Cruz
collection DOAJ
description   Los atletas son expuestos a cargas de alta intensidad en la búsqueda del rendimiento deportivo, sin embargo, sus efectos no se evalúan apropiadamente. El presente estudio analiza los efectos de cuatro diferentes tipos de ejercicios sobre la variabilidad de la frecuencia cardíaca (VFC), diagrama de Poincaré (SD1: desviación estándar 1 y SD2: desviación estándar 2), así como la Creatina Cinasa (CK) y las concentraciones de lactato en sangre como marcadores de fatiga. Para lograr el objetivo, participaron 10 voluntarios sanos quienes se expusieron a fatiga mediante protocolos de ejercicio isotónicos, isométricos, aeróbicos y anaeróbicos. Se tomaron muestras de la SD1 y de la SD2 para posteriormente probar el comportamiento de la fatiga mediante el índice de estrés (SS) como parámetro simpático, y el índice simpático/parasimpático (S/PS), además se midió la raíz cuadrada media de las diferencias sucesivas (rMSSD) como indicadores parasimpáticos. Se recolectaron muestras sanguíneas al comienzo y al final de cada uno de los tipos de ejercicio para determinar los niveles de CK y lactato. La SD1 disminuye en cada protocolo de ejercicio, mientras que el SS y el S/PS incrementan. Lactato y CK incrementan al final de cada protocolo y correlacionan positivamente con el SD1 y S/PS. La VFC, CK y lactato son marcadores sensibles para la detección de fatiga, son sensibles tanto al tipo, duración e intensidad del ejercicio, siendo la VFC un marcador no invasivo y novedoso, simple y útil para los entrenadores y atletas.  Abstract: Athletes are exposed to high-intensity loads to promote athletic performance, however, the effects are not evaluated appropriately. This study investigates the effects of four types of exhaustion exercises on Heart Rate Variability (HRV) and Poincaré features (SD1: Standard deviation 1and SD2: Standard deviation 2), Creatine Kinase (CK) and blood lactate concentrations as biomarkers of fatigue. To achieve this purpose, 10 healthy volunteers were exposed to exhaustive exercise using isotonic, isometric, aerobic and anaerobic fatigue protocols. HRV Poincaré features, standard deviation of instantaneous beat-to-beat R-R interval variability (SD1) and standard deviation of continuous long-term R-R interval variability (SD2) variables were collected. Fatigue was tested through the sympathetic stress index (SS), the index sympathetic/parasympathetic index (S/PS) and the root Mean Square of the Successive Differences (rMSSD) as parasympathetic index. Blood samples were collected at the beginning and at the end of the exercises to determine CK and lactate. The SD1 decreased in each exercise protocol, while the SS and S/PS increased. Lactate and CK increased at the end of each protocol and correlated with SD1 and S/PS. HRV, CK, and lactate are acute markers to detect fatigue, are sensitive to the type, duration, and intensity of exercise, being HRV a novel noninvasive marker, simple and useful for sports coaches and athletes.
format Article
id doaj-art-b55bb19ebd5a4779a8745bbcc2f74ed9
institution OA Journals
issn 1579-1726
1988-2041
language English
publishDate 2022-04-01
publisher FEADEF
record_format Article
series Retos: Nuevas Tendencias en Educación Física, Deportes y Recreación
spelling doaj-art-b55bb19ebd5a4779a8745bbcc2f74ed92025-08-20T02:35:14ZengFEADEFRetos: Nuevas Tendencias en Educación Física, Deportes y Recreación1579-17261988-20412022-04-014410.47197/retos.v44i0.89479Relación entre el tipo de ejercicio físico y la fatiga cuantificada mediante VFC, CK y el lactato en sangre (Relationship between physical exercise type and fatigue quantified through HRV, CK, and blood lactate)German Hernández-Cruz0Edson Francisco Estrada-Meneses1Arnulfo Ramos-Jiménez2Blanca Rocío Rangel-Colmenero3Luis Felipe Reynoso-Sánchez4Janeth Miranda-Mendoza5José Trinidad Quezada-Chacón6Facultad de Organización Deportiva, Universidad Autónoma de Nuevo LeónInstituto de Ciencias Biomédicas, Universidad Autónoma de Ciudad JuárezInstituto de Ciencias Biomédicas, Universidad Autónoma de Ciudad JuárezFacultad de Organización Deportiva, Universidad Autónoma de Nuevo LeónDepartamento de Ciencias Sociales y Humanidades, Universidad Autónoma de OccidenteFacultad de Organización Deportiva, Universidad Autónoma de Nuevo LeónInstituto de Ciencias Biomédicas, Universidad Autónoma de Ciudad Juárez   Los atletas son expuestos a cargas de alta intensidad en la búsqueda del rendimiento deportivo, sin embargo, sus efectos no se evalúan apropiadamente. El presente estudio analiza los efectos de cuatro diferentes tipos de ejercicios sobre la variabilidad de la frecuencia cardíaca (VFC), diagrama de Poincaré (SD1: desviación estándar 1 y SD2: desviación estándar 2), así como la Creatina Cinasa (CK) y las concentraciones de lactato en sangre como marcadores de fatiga. Para lograr el objetivo, participaron 10 voluntarios sanos quienes se expusieron a fatiga mediante protocolos de ejercicio isotónicos, isométricos, aeróbicos y anaeróbicos. Se tomaron muestras de la SD1 y de la SD2 para posteriormente probar el comportamiento de la fatiga mediante el índice de estrés (SS) como parámetro simpático, y el índice simpático/parasimpático (S/PS), además se midió la raíz cuadrada media de las diferencias sucesivas (rMSSD) como indicadores parasimpáticos. Se recolectaron muestras sanguíneas al comienzo y al final de cada uno de los tipos de ejercicio para determinar los niveles de CK y lactato. La SD1 disminuye en cada protocolo de ejercicio, mientras que el SS y el S/PS incrementan. Lactato y CK incrementan al final de cada protocolo y correlacionan positivamente con el SD1 y S/PS. La VFC, CK y lactato son marcadores sensibles para la detección de fatiga, son sensibles tanto al tipo, duración e intensidad del ejercicio, siendo la VFC un marcador no invasivo y novedoso, simple y útil para los entrenadores y atletas.  Abstract: Athletes are exposed to high-intensity loads to promote athletic performance, however, the effects are not evaluated appropriately. This study investigates the effects of four types of exhaustion exercises on Heart Rate Variability (HRV) and Poincaré features (SD1: Standard deviation 1and SD2: Standard deviation 2), Creatine Kinase (CK) and blood lactate concentrations as biomarkers of fatigue. To achieve this purpose, 10 healthy volunteers were exposed to exhaustive exercise using isotonic, isometric, aerobic and anaerobic fatigue protocols. HRV Poincaré features, standard deviation of instantaneous beat-to-beat R-R interval variability (SD1) and standard deviation of continuous long-term R-R interval variability (SD2) variables were collected. Fatigue was tested through the sympathetic stress index (SS), the index sympathetic/parasympathetic index (S/PS) and the root Mean Square of the Successive Differences (rMSSD) as parasympathetic index. Blood samples were collected at the beginning and at the end of the exercises to determine CK and lactate. The SD1 decreased in each exercise protocol, while the SS and S/PS increased. Lactate and CK increased at the end of each protocol and correlated with SD1 and S/PS. HRV, CK, and lactate are acute markers to detect fatigue, are sensitive to the type, duration, and intensity of exercise, being HRV a novel noninvasive marker, simple and useful for sports coaches and athletes. https://recyt.fecyt.es/index.php/retos/article/view/89479Rendimiento deportivo, medición, biomarcadores de estrés físico, test(Sports performance, physical stress biomarkers, physical performance test)
spellingShingle German Hernández-Cruz
Edson Francisco Estrada-Meneses
Arnulfo Ramos-Jiménez
Blanca Rocío Rangel-Colmenero
Luis Felipe Reynoso-Sánchez
Janeth Miranda-Mendoza
José Trinidad Quezada-Chacón
Relación entre el tipo de ejercicio físico y la fatiga cuantificada mediante VFC, CK y el lactato en sangre (Relationship between physical exercise type and fatigue quantified through HRV, CK, and blood lactate)
Retos: Nuevas Tendencias en Educación Física, Deportes y Recreación
Rendimiento deportivo, medición, biomarcadores de estrés físico, test
(Sports performance, physical stress biomarkers, physical performance test)
title Relación entre el tipo de ejercicio físico y la fatiga cuantificada mediante VFC, CK y el lactato en sangre (Relationship between physical exercise type and fatigue quantified through HRV, CK, and blood lactate)
title_full Relación entre el tipo de ejercicio físico y la fatiga cuantificada mediante VFC, CK y el lactato en sangre (Relationship between physical exercise type and fatigue quantified through HRV, CK, and blood lactate)
title_fullStr Relación entre el tipo de ejercicio físico y la fatiga cuantificada mediante VFC, CK y el lactato en sangre (Relationship between physical exercise type and fatigue quantified through HRV, CK, and blood lactate)
title_full_unstemmed Relación entre el tipo de ejercicio físico y la fatiga cuantificada mediante VFC, CK y el lactato en sangre (Relationship between physical exercise type and fatigue quantified through HRV, CK, and blood lactate)
title_short Relación entre el tipo de ejercicio físico y la fatiga cuantificada mediante VFC, CK y el lactato en sangre (Relationship between physical exercise type and fatigue quantified through HRV, CK, and blood lactate)
title_sort relacion entre el tipo de ejercicio fisico y la fatiga cuantificada mediante vfc ck y el lactato en sangre relationship between physical exercise type and fatigue quantified through hrv ck and blood lactate
topic Rendimiento deportivo, medición, biomarcadores de estrés físico, test
(Sports performance, physical stress biomarkers, physical performance test)
url https://recyt.fecyt.es/index.php/retos/article/view/89479
work_keys_str_mv AT germanhernandezcruz relacionentreeltipodeejerciciofisicoylafatigacuantificadamediantevfcckyellactatoensangrerelationshipbetweenphysicalexercisetypeandfatiguequantifiedthroughhrvckandbloodlactate
AT edsonfranciscoestradameneses relacionentreeltipodeejerciciofisicoylafatigacuantificadamediantevfcckyellactatoensangrerelationshipbetweenphysicalexercisetypeandfatiguequantifiedthroughhrvckandbloodlactate
AT arnulforamosjimenez relacionentreeltipodeejerciciofisicoylafatigacuantificadamediantevfcckyellactatoensangrerelationshipbetweenphysicalexercisetypeandfatiguequantifiedthroughhrvckandbloodlactate
AT blancarociorangelcolmenero relacionentreeltipodeejerciciofisicoylafatigacuantificadamediantevfcckyellactatoensangrerelationshipbetweenphysicalexercisetypeandfatiguequantifiedthroughhrvckandbloodlactate
AT luisfelipereynososanchez relacionentreeltipodeejerciciofisicoylafatigacuantificadamediantevfcckyellactatoensangrerelationshipbetweenphysicalexercisetypeandfatiguequantifiedthroughhrvckandbloodlactate
AT janethmirandamendoza relacionentreeltipodeejerciciofisicoylafatigacuantificadamediantevfcckyellactatoensangrerelationshipbetweenphysicalexercisetypeandfatiguequantifiedthroughhrvckandbloodlactate
AT josetrinidadquezadachacon relacionentreeltipodeejerciciofisicoylafatigacuantificadamediantevfcckyellactatoensangrerelationshipbetweenphysicalexercisetypeandfatiguequantifiedthroughhrvckandbloodlactate