Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review

A rapid review was conducted to explore the implementation determinants of human papillomavirus (HPV) vaccination in the World Health Organization African Region and describe their dynamic relationship. PubMed and Google Scholar were searched in October 2023 to find relevant literature. A total of 6...

Full description

Saved in:
Bibliographic Details
Main Authors: Abdu A. Adamu, Rabiu I. Jalo, Duduzile Ndwandwe, Charles S. Wiysonge
Format: Article
Language:English
Published: Taylor & Francis Group 2024-12-01
Series:Human Vaccines & Immunotherapeutics
Subjects:
Online Access:https://www.tandfonline.com/doi/10.1080/21645515.2024.2381922
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850185283102834688
author Abdu A. Adamu
Rabiu I. Jalo
Duduzile Ndwandwe
Charles S. Wiysonge
author_facet Abdu A. Adamu
Rabiu I. Jalo
Duduzile Ndwandwe
Charles S. Wiysonge
author_sort Abdu A. Adamu
collection DOAJ
description A rapid review was conducted to explore the implementation determinants of human papillomavirus (HPV) vaccination in the World Health Organization African Region and describe their dynamic relationship. PubMed and Google Scholar were searched in October 2023 to find relevant literature. A total of 64 published studies that reported factors affecting HPV vaccination were identified. Analysis of identified factors yielded 74 implementation determinants of HPV vaccination across the five domains of the Consolidated Framework for Implementation Research (CFIR): two (2.70%) were in the innovation domain, seven (9.46%) were in the outer setting domain, 14 (18.92%) were in the inner setting domain, 37 (50%) were in the individual domain and 14 (18.92%) were in the implementation process domain. A causal loop diagram of these implementation determinants revealed four balancing and seven reinforcing loops. Applying systems lens promoted a more holistic understanding of the implementation determinants of HPV vaccination, exposing leverage points for interventions.
format Article
id doaj-art-b361106420604241a18a5bfaaa3e77c1
institution OA Journals
issn 2164-5515
2164-554X
language English
publishDate 2024-12-01
publisher Taylor & Francis Group
record_format Article
series Human Vaccines & Immunotherapeutics
spelling doaj-art-b361106420604241a18a5bfaaa3e77c12025-08-20T02:16:48ZengTaylor & Francis GroupHuman Vaccines & Immunotherapeutics2164-55152164-554X2024-12-0120110.1080/21645515.2024.2381922Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid reviewAbdu A. Adamu0Rabiu I. Jalo1Duduzile Ndwandwe2Charles S. Wiysonge3Polio Eradication Programme, World Health Organization Region Office for Africa, Djoue, CongoDepartment of Community Medicine, Faculty of Clinical Sciences, Bayero University/Aminu Kano Teaching Hospital, Kano, NigeriaCochrane South Africa, South African Medical Research Council, Cape Town, South AfricaVaccine-Preventable Diseases Programme, World Health Organization Regional Office for Africa, Djoue, CongoA rapid review was conducted to explore the implementation determinants of human papillomavirus (HPV) vaccination in the World Health Organization African Region and describe their dynamic relationship. PubMed and Google Scholar were searched in October 2023 to find relevant literature. A total of 64 published studies that reported factors affecting HPV vaccination were identified. Analysis of identified factors yielded 74 implementation determinants of HPV vaccination across the five domains of the Consolidated Framework for Implementation Research (CFIR): two (2.70%) were in the innovation domain, seven (9.46%) were in the outer setting domain, 14 (18.92%) were in the inner setting domain, 37 (50%) were in the individual domain and 14 (18.92%) were in the implementation process domain. A causal loop diagram of these implementation determinants revealed four balancing and seven reinforcing loops. Applying systems lens promoted a more holistic understanding of the implementation determinants of HPV vaccination, exposing leverage points for interventions.https://www.tandfonline.com/doi/10.1080/21645515.2024.2381922Human papillomavirus vaccineimplementation determinantssystems thinkingAfrican Regioncervical cancer controlrapid review
spellingShingle Abdu A. Adamu
Rabiu I. Jalo
Duduzile Ndwandwe
Charles S. Wiysonge
Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review
Human Vaccines & Immunotherapeutics
Human papillomavirus vaccine
implementation determinants
systems thinking
African Region
cervical cancer control
rapid review
title Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review
title_full Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review
title_fullStr Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review
title_full_unstemmed Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review
title_short Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review
title_sort exploring the complexity of the implementation determinants of human papillomavirus vaccination in africa through a systems thinking lens a rapid review
topic Human papillomavirus vaccine
implementation determinants
systems thinking
African Region
cervical cancer control
rapid review
url https://www.tandfonline.com/doi/10.1080/21645515.2024.2381922
work_keys_str_mv AT abduaadamu exploringthecomplexityoftheimplementationdeterminantsofhumanpapillomavirusvaccinationinafricathroughasystemsthinkinglensarapidreview
AT rabiuijalo exploringthecomplexityoftheimplementationdeterminantsofhumanpapillomavirusvaccinationinafricathroughasystemsthinkinglensarapidreview
AT duduzilendwandwe exploringthecomplexityoftheimplementationdeterminantsofhumanpapillomavirusvaccinationinafricathroughasystemsthinkinglensarapidreview
AT charlesswiysonge exploringthecomplexityoftheimplementationdeterminantsofhumanpapillomavirusvaccinationinafricathroughasystemsthinkinglensarapidreview