Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review
A rapid review was conducted to explore the implementation determinants of human papillomavirus (HPV) vaccination in the World Health Organization African Region and describe their dynamic relationship. PubMed and Google Scholar were searched in October 2023 to find relevant literature. A total of 6...
Saved in:
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Taylor & Francis Group
2024-12-01
|
| Series: | Human Vaccines & Immunotherapeutics |
| Subjects: | |
| Online Access: | https://www.tandfonline.com/doi/10.1080/21645515.2024.2381922 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850185283102834688 |
|---|---|
| author | Abdu A. Adamu Rabiu I. Jalo Duduzile Ndwandwe Charles S. Wiysonge |
| author_facet | Abdu A. Adamu Rabiu I. Jalo Duduzile Ndwandwe Charles S. Wiysonge |
| author_sort | Abdu A. Adamu |
| collection | DOAJ |
| description | A rapid review was conducted to explore the implementation determinants of human papillomavirus (HPV) vaccination in the World Health Organization African Region and describe their dynamic relationship. PubMed and Google Scholar were searched in October 2023 to find relevant literature. A total of 64 published studies that reported factors affecting HPV vaccination were identified. Analysis of identified factors yielded 74 implementation determinants of HPV vaccination across the five domains of the Consolidated Framework for Implementation Research (CFIR): two (2.70%) were in the innovation domain, seven (9.46%) were in the outer setting domain, 14 (18.92%) were in the inner setting domain, 37 (50%) were in the individual domain and 14 (18.92%) were in the implementation process domain. A causal loop diagram of these implementation determinants revealed four balancing and seven reinforcing loops. Applying systems lens promoted a more holistic understanding of the implementation determinants of HPV vaccination, exposing leverage points for interventions. |
| format | Article |
| id | doaj-art-b361106420604241a18a5bfaaa3e77c1 |
| institution | OA Journals |
| issn | 2164-5515 2164-554X |
| language | English |
| publishDate | 2024-12-01 |
| publisher | Taylor & Francis Group |
| record_format | Article |
| series | Human Vaccines & Immunotherapeutics |
| spelling | doaj-art-b361106420604241a18a5bfaaa3e77c12025-08-20T02:16:48ZengTaylor & Francis GroupHuman Vaccines & Immunotherapeutics2164-55152164-554X2024-12-0120110.1080/21645515.2024.2381922Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid reviewAbdu A. Adamu0Rabiu I. Jalo1Duduzile Ndwandwe2Charles S. Wiysonge3Polio Eradication Programme, World Health Organization Region Office for Africa, Djoue, CongoDepartment of Community Medicine, Faculty of Clinical Sciences, Bayero University/Aminu Kano Teaching Hospital, Kano, NigeriaCochrane South Africa, South African Medical Research Council, Cape Town, South AfricaVaccine-Preventable Diseases Programme, World Health Organization Regional Office for Africa, Djoue, CongoA rapid review was conducted to explore the implementation determinants of human papillomavirus (HPV) vaccination in the World Health Organization African Region and describe their dynamic relationship. PubMed and Google Scholar were searched in October 2023 to find relevant literature. A total of 64 published studies that reported factors affecting HPV vaccination were identified. Analysis of identified factors yielded 74 implementation determinants of HPV vaccination across the five domains of the Consolidated Framework for Implementation Research (CFIR): two (2.70%) were in the innovation domain, seven (9.46%) were in the outer setting domain, 14 (18.92%) were in the inner setting domain, 37 (50%) were in the individual domain and 14 (18.92%) were in the implementation process domain. A causal loop diagram of these implementation determinants revealed four balancing and seven reinforcing loops. Applying systems lens promoted a more holistic understanding of the implementation determinants of HPV vaccination, exposing leverage points for interventions.https://www.tandfonline.com/doi/10.1080/21645515.2024.2381922Human papillomavirus vaccineimplementation determinantssystems thinkingAfrican Regioncervical cancer controlrapid review |
| spellingShingle | Abdu A. Adamu Rabiu I. Jalo Duduzile Ndwandwe Charles S. Wiysonge Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review Human Vaccines & Immunotherapeutics Human papillomavirus vaccine implementation determinants systems thinking African Region cervical cancer control rapid review |
| title | Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review |
| title_full | Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review |
| title_fullStr | Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review |
| title_full_unstemmed | Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review |
| title_short | Exploring the complexity of the implementation determinants of human papillomavirus vaccination in Africa through a systems thinking lens: A rapid review |
| title_sort | exploring the complexity of the implementation determinants of human papillomavirus vaccination in africa through a systems thinking lens a rapid review |
| topic | Human papillomavirus vaccine implementation determinants systems thinking African Region cervical cancer control rapid review |
| url | https://www.tandfonline.com/doi/10.1080/21645515.2024.2381922 |
| work_keys_str_mv | AT abduaadamu exploringthecomplexityoftheimplementationdeterminantsofhumanpapillomavirusvaccinationinafricathroughasystemsthinkinglensarapidreview AT rabiuijalo exploringthecomplexityoftheimplementationdeterminantsofhumanpapillomavirusvaccinationinafricathroughasystemsthinkinglensarapidreview AT duduzilendwandwe exploringthecomplexityoftheimplementationdeterminantsofhumanpapillomavirusvaccinationinafricathroughasystemsthinkinglensarapidreview AT charlesswiysonge exploringthecomplexityoftheimplementationdeterminantsofhumanpapillomavirusvaccinationinafricathroughasystemsthinkinglensarapidreview |