Alpha-enolase promotes progression of acute myeloid leukemia via MAPK/ERK signaling pathway

Due to the limited availability of effective treatment therapies, patients with refractory and relapsed acute myeloid leukemia (AML) often have poor prognoses. Therefore, identifying new therapeutic targets to improve the treatment landscape and enhance AML outcomes is critical. In this study, we de...

Full description

Saved in:
Bibliographic Details
Main Authors: Shanshan Zhang, Haina Wang, Xuehong Zhang, Xiangjie Kui, Dan Huang, Menglu Qin, Shuqing Liu, Ming-Zhong Sun, Jinsong Yan
Format: Article
Language:English
Published: Wolters Kluwer Health 2025-09-01
Series:Blood Science
Online Access:http://journals.lww.com/10.1097/BS9.0000000000000246
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1849222757279072256
author Shanshan Zhang
Haina Wang
Xuehong Zhang
Xiangjie Kui
Dan Huang
Menglu Qin
Shuqing Liu
Ming-Zhong Sun
Jinsong Yan
author_facet Shanshan Zhang
Haina Wang
Xuehong Zhang
Xiangjie Kui
Dan Huang
Menglu Qin
Shuqing Liu
Ming-Zhong Sun
Jinsong Yan
author_sort Shanshan Zhang
collection DOAJ
description Due to the limited availability of effective treatment therapies, patients with refractory and relapsed acute myeloid leukemia (AML) often have poor prognoses. Therefore, identifying new therapeutic targets to improve the treatment landscape and enhance AML outcomes is critical. In this study, we demonstrated for the first time that alpha-enolase (ENO1) is markedly overexpressed in AML and is closely associated with poor prognosis. In vitro experiments revealed that ENO1 knockdown (shENO1) significantly inhibited cell proliferation and invasion, and concomitantly induced cell cycle arrest. In vivo, a mouse model engrafted with U937-shENO1 cells exhibited markedly prolonged overall survival compared with a model implanted with U937 cells. Mechanistically, ENO1 operates by activating the mitogen-activated protein kinase/extracellular signal-regulated kinase (MAPK/ERK) signaling pathway, as evidenced by the reversal of shENO1 function through ERK activation. Collectively, our findings highlight ENO1 as a promising therapeutic target in AML.
format Article
id doaj-art-b2f3944a97114251832b010c623ecfbd
institution Kabale University
issn 2543-6368
language English
publishDate 2025-09-01
publisher Wolters Kluwer Health
record_format Article
series Blood Science
spelling doaj-art-b2f3944a97114251832b010c623ecfbd2025-08-26T03:22:27ZengWolters Kluwer HealthBlood Science2543-63682025-09-0173e0024610.1097/BS9.0000000000000246202509000-00008Alpha-enolase promotes progression of acute myeloid leukemia via MAPK/ERK signaling pathwayShanshan Zhang0Haina Wang1Xuehong Zhang2Xiangjie Kui3Dan Huang4Menglu Qin5Shuqing Liu6Ming-Zhong Sun7Jinsong Yan8a Department of Hematology, Liaoning Medical Center for Hematopoietic Stem Cell Transplantation, the Second Hospital of Dalian Medical University, Dalian 116027, Chinaa Department of Hematology, Liaoning Medical Center for Hematopoietic Stem Cell Transplantation, the Second Hospital of Dalian Medical University, Dalian 116027, Chinad Center of Genome and Personalized Medicine, Institute of Cancer Stem Cell, Dalian Medical University, Dalian 116044, Chinaa Department of Hematology, Liaoning Medical Center for Hematopoietic Stem Cell Transplantation, the Second Hospital of Dalian Medical University, Dalian 116027, Chinaa Department of Hematology, Liaoning Medical Center for Hematopoietic Stem Cell Transplantation, the Second Hospital of Dalian Medical University, Dalian 116027, Chinac Liaoning Key Laboratory of Hematopoietic Stem Cell Transplantation and Translational Medicine, Blood Stem Cell Transplantation Institute, Dalian Key Laboratory of hematology, Diamond Bay Institute of Hematology, the Second Hospital of Dalian Medical University, Dalian 116027, Chinae Department of Biochemistry, College of Basic Medical Sciences, Dalian Medical University, Dalian 116044, Chinab Department of Biotechnology, College of Basic Medical Sciences, Dalian Medical University, Dalian 116044, Chinaa Department of Hematology, Liaoning Medical Center for Hematopoietic Stem Cell Transplantation, the Second Hospital of Dalian Medical University, Dalian 116027, ChinaDue to the limited availability of effective treatment therapies, patients with refractory and relapsed acute myeloid leukemia (AML) often have poor prognoses. Therefore, identifying new therapeutic targets to improve the treatment landscape and enhance AML outcomes is critical. In this study, we demonstrated for the first time that alpha-enolase (ENO1) is markedly overexpressed in AML and is closely associated with poor prognosis. In vitro experiments revealed that ENO1 knockdown (shENO1) significantly inhibited cell proliferation and invasion, and concomitantly induced cell cycle arrest. In vivo, a mouse model engrafted with U937-shENO1 cells exhibited markedly prolonged overall survival compared with a model implanted with U937 cells. Mechanistically, ENO1 operates by activating the mitogen-activated protein kinase/extracellular signal-regulated kinase (MAPK/ERK) signaling pathway, as evidenced by the reversal of shENO1 function through ERK activation. Collectively, our findings highlight ENO1 as a promising therapeutic target in AML.http://journals.lww.com/10.1097/BS9.0000000000000246
spellingShingle Shanshan Zhang
Haina Wang
Xuehong Zhang
Xiangjie Kui
Dan Huang
Menglu Qin
Shuqing Liu
Ming-Zhong Sun
Jinsong Yan
Alpha-enolase promotes progression of acute myeloid leukemia via MAPK/ERK signaling pathway
Blood Science
title Alpha-enolase promotes progression of acute myeloid leukemia via MAPK/ERK signaling pathway
title_full Alpha-enolase promotes progression of acute myeloid leukemia via MAPK/ERK signaling pathway
title_fullStr Alpha-enolase promotes progression of acute myeloid leukemia via MAPK/ERK signaling pathway
title_full_unstemmed Alpha-enolase promotes progression of acute myeloid leukemia via MAPK/ERK signaling pathway
title_short Alpha-enolase promotes progression of acute myeloid leukemia via MAPK/ERK signaling pathway
title_sort alpha enolase promotes progression of acute myeloid leukemia via mapk erk signaling pathway
url http://journals.lww.com/10.1097/BS9.0000000000000246
work_keys_str_mv AT shanshanzhang alphaenolasepromotesprogressionofacutemyeloidleukemiaviamapkerksignalingpathway
AT hainawang alphaenolasepromotesprogressionofacutemyeloidleukemiaviamapkerksignalingpathway
AT xuehongzhang alphaenolasepromotesprogressionofacutemyeloidleukemiaviamapkerksignalingpathway
AT xiangjiekui alphaenolasepromotesprogressionofacutemyeloidleukemiaviamapkerksignalingpathway
AT danhuang alphaenolasepromotesprogressionofacutemyeloidleukemiaviamapkerksignalingpathway
AT mengluqin alphaenolasepromotesprogressionofacutemyeloidleukemiaviamapkerksignalingpathway
AT shuqingliu alphaenolasepromotesprogressionofacutemyeloidleukemiaviamapkerksignalingpathway
AT mingzhongsun alphaenolasepromotesprogressionofacutemyeloidleukemiaviamapkerksignalingpathway
AT jinsongyan alphaenolasepromotesprogressionofacutemyeloidleukemiaviamapkerksignalingpathway