A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids.

Banana bunchy top virus (BBTV) is a six-component ssDNA virus (genus Babuvirus, family Nanoviridae) transmitted by aphids, infecting monocots (mainly species in the family Musaceae) and likely originating from South-East Asia where it is frequently associated with self-replicating alphasatellites. I...

Full description

Saved in:
Bibliographic Details
Main Authors: Valentin Guyot, Rajendran Rajeswaran, Huong Cam Chu, Chockalingam Karthikeyan, Nathalie Laboureau, Serge Galzi, Lyna F T Mukwa, Mart Krupovic, P Lava Kumar, Marie-Line Iskra-Caruana, Mikhail M Pooggin
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2022-04-01
Series:PLoS Pathogens
Online Access:https://journals.plos.org/plospathogens/article/file?id=10.1371/journal.ppat.1010448&type=printable
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850075022417199104
author Valentin Guyot
Rajendran Rajeswaran
Huong Cam Chu
Chockalingam Karthikeyan
Nathalie Laboureau
Serge Galzi
Lyna F T Mukwa
Mart Krupovic
P Lava Kumar
Marie-Line Iskra-Caruana
Mikhail M Pooggin
author_facet Valentin Guyot
Rajendran Rajeswaran
Huong Cam Chu
Chockalingam Karthikeyan
Nathalie Laboureau
Serge Galzi
Lyna F T Mukwa
Mart Krupovic
P Lava Kumar
Marie-Line Iskra-Caruana
Mikhail M Pooggin
author_sort Valentin Guyot
collection DOAJ
description Banana bunchy top virus (BBTV) is a six-component ssDNA virus (genus Babuvirus, family Nanoviridae) transmitted by aphids, infecting monocots (mainly species in the family Musaceae) and likely originating from South-East Asia where it is frequently associated with self-replicating alphasatellites. Illumina sequencing analysis of banana aphids and leaf samples from Africa revealed an alphasatellite that should be classified in a new genus, phylogenetically related to alphasatellites of nanoviruses infecting dicots. Alphasatellite DNA was encapsidated by BBTV coat protein and accumulated at high levels in plants and aphids, thereby reducing helper virus loads, altering relative abundance (formula) of viral genome components and interfering with virus transmission by aphids. BBTV and alphasatellite clones infected dicot Nicotiana benthamiana, followed by recovery and symptomless persistence of alphasatellite, and BBTV replication protein (Rep), but not alphasatellite Rep, induced leaf chlorosis. Transcriptome sequencing revealed 21, 22 and 24 nucleotide small interfering (si)RNAs covering both strands of the entire viral genome, monodirectional Pol II transcription units of viral mRNAs and pervasive transcription of each component and alphasatellite in both directions, likely generating double-stranded precursors of viral siRNAs. Consistent with the latter hypothesis, viral DNA formulas with and without alphasatellite resembled viral siRNA formulas but not mRNA formulas. Alphasatellite decreased transcription efficiency of DNA-N encoding a putative aphid transmission factor and increased relative siRNA production rates from Rep- and movement protein-encoding components. Alphasatellite itself spawned the most abundant siRNAs and had the lowest mRNA transcription rate. Collectively, following African invasion, BBTV got associated with an alphasatellite likely originating from a dicot plant and interfering with BBTV replication and transmission. Molecular analysis of virus-infected banana plants revealed new features of viral DNA transcription and siRNA biogenesis, both affected by alphasatellite. Costs and benefits of alphasatellite association with helper viruses are discussed.
format Article
id doaj-art-abb95e94488b4abda38b1be78887fe76
institution DOAJ
issn 1553-7366
1553-7374
language English
publishDate 2022-04-01
publisher Public Library of Science (PLoS)
record_format Article
series PLoS Pathogens
spelling doaj-art-abb95e94488b4abda38b1be78887fe762025-08-20T02:46:25ZengPublic Library of Science (PLoS)PLoS Pathogens1553-73661553-73742022-04-01184e101044810.1371/journal.ppat.1010448A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids.Valentin GuyotRajendran RajeswaranHuong Cam ChuChockalingam KarthikeyanNathalie LaboureauSerge GalziLyna F T MukwaMart KrupovicP Lava KumarMarie-Line Iskra-CaruanaMikhail M PoogginBanana bunchy top virus (BBTV) is a six-component ssDNA virus (genus Babuvirus, family Nanoviridae) transmitted by aphids, infecting monocots (mainly species in the family Musaceae) and likely originating from South-East Asia where it is frequently associated with self-replicating alphasatellites. Illumina sequencing analysis of banana aphids and leaf samples from Africa revealed an alphasatellite that should be classified in a new genus, phylogenetically related to alphasatellites of nanoviruses infecting dicots. Alphasatellite DNA was encapsidated by BBTV coat protein and accumulated at high levels in plants and aphids, thereby reducing helper virus loads, altering relative abundance (formula) of viral genome components and interfering with virus transmission by aphids. BBTV and alphasatellite clones infected dicot Nicotiana benthamiana, followed by recovery and symptomless persistence of alphasatellite, and BBTV replication protein (Rep), but not alphasatellite Rep, induced leaf chlorosis. Transcriptome sequencing revealed 21, 22 and 24 nucleotide small interfering (si)RNAs covering both strands of the entire viral genome, monodirectional Pol II transcription units of viral mRNAs and pervasive transcription of each component and alphasatellite in both directions, likely generating double-stranded precursors of viral siRNAs. Consistent with the latter hypothesis, viral DNA formulas with and without alphasatellite resembled viral siRNA formulas but not mRNA formulas. Alphasatellite decreased transcription efficiency of DNA-N encoding a putative aphid transmission factor and increased relative siRNA production rates from Rep- and movement protein-encoding components. Alphasatellite itself spawned the most abundant siRNAs and had the lowest mRNA transcription rate. Collectively, following African invasion, BBTV got associated with an alphasatellite likely originating from a dicot plant and interfering with BBTV replication and transmission. Molecular analysis of virus-infected banana plants revealed new features of viral DNA transcription and siRNA biogenesis, both affected by alphasatellite. Costs and benefits of alphasatellite association with helper viruses are discussed.https://journals.plos.org/plospathogens/article/file?id=10.1371/journal.ppat.1010448&type=printable
spellingShingle Valentin Guyot
Rajendran Rajeswaran
Huong Cam Chu
Chockalingam Karthikeyan
Nathalie Laboureau
Serge Galzi
Lyna F T Mukwa
Mart Krupovic
P Lava Kumar
Marie-Line Iskra-Caruana
Mikhail M Pooggin
A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids.
PLoS Pathogens
title A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids.
title_full A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids.
title_fullStr A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids.
title_full_unstemmed A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids.
title_short A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids.
title_sort newly emerging alphasatellite affects banana bunchy top virus replication transcription sirna production and transmission by aphids
url https://journals.plos.org/plospathogens/article/file?id=10.1371/journal.ppat.1010448&type=printable
work_keys_str_mv AT valentinguyot anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT rajendranrajeswaran anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT huongcamchu anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT chockalingamkarthikeyan anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT nathalielaboureau anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT sergegalzi anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT lynaftmukwa anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT martkrupovic anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT plavakumar anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT marielineiskracaruana anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT mikhailmpooggin anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT valentinguyot newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT rajendranrajeswaran newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT huongcamchu newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT chockalingamkarthikeyan newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT nathalielaboureau newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT sergegalzi newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT lynaftmukwa newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT martkrupovic newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT plavakumar newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT marielineiskracaruana newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT mikhailmpooggin newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids