The Conditioned Medium of Calcined Tooth Powder Promotes the Osteogenic and Odontogenic Differentiation of Human Dental Pulp Stem Cells via MAPK Signaling Pathways
The calcined tooth powder (CTP), a type of allogeneic biomimetic mineralized material, has been confirmed that can promote new bone formation when obtained at high temperature. The aim of this study was to investigate effects of the conditioned medium of calcined tooth powder (CTP-CM) on the osteoge...
Saved in:
| Main Authors: | , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2019-01-01
|
| Series: | Stem Cells International |
| Online Access: | http://dx.doi.org/10.1155/2019/4793518 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832564983363272704 |
|---|---|
| author | Jintao Wu Na Li Yuan Fan Yanqiu Wang Yongchun Gu Zehan Li Yin Pan Gobin Romila Zuomin Zhou Jinhua Yu |
| author_facet | Jintao Wu Na Li Yuan Fan Yanqiu Wang Yongchun Gu Zehan Li Yin Pan Gobin Romila Zuomin Zhou Jinhua Yu |
| author_sort | Jintao Wu |
| collection | DOAJ |
| description | The calcined tooth powder (CTP), a type of allogeneic biomimetic mineralized material, has been confirmed that can promote new bone formation when obtained at high temperature. The aim of this study was to investigate effects of the conditioned medium of calcined tooth powder (CTP-CM) on the osteogenic and odontogenic differentiation of human dental pulp stem cells (hDPSCs) and the underlying mechanisms involved. First, ALP activity assay determined that 200 μg/mL was the optimal concentration of CTP-CM for the following experiments. CTP-CM had no significant effect on the proliferation of hDPSCs as indicated by CCK-8 and FCM analysis. Both the gene and protein (DSPP/DSPP, RUNX2/RUNX2, OCN/OCN, OSX/OSX, OPN/OPN, ALP/ALP, and COL-1/COL-1) expression levels increased in the CTP-CM-induced hDPSC group as compared with those in the control group at day 3 or 7, showing the positive regulation of CTP-CM on the osteo/odontogenic differentiation of hDPSCs. Mechanistically, MAPK signaling pathways were activated after the CTP-CM treatment, and the inhibitors targeting MAPK were identified which weakened the effects of CTM-CM on the committed differentiation of hDPSCs. These findings could lead to the creation of stem cell therapies for dental regeneration. |
| format | Article |
| id | doaj-art-a8cbdf1c9b50473483bbf906597cf45a |
| institution | Kabale University |
| issn | 1687-966X 1687-9678 |
| language | English |
| publishDate | 2019-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | Stem Cells International |
| spelling | doaj-art-a8cbdf1c9b50473483bbf906597cf45a2025-02-03T01:09:49ZengWileyStem Cells International1687-966X1687-96782019-01-01201910.1155/2019/47935184793518The Conditioned Medium of Calcined Tooth Powder Promotes the Osteogenic and Odontogenic Differentiation of Human Dental Pulp Stem Cells via MAPK Signaling PathwaysJintao Wu0Na Li1Yuan Fan2Yanqiu Wang3Yongchun Gu4Zehan Li5Yin Pan6Gobin Romila7Zuomin Zhou8Jinhua Yu9Endodontic Department, School of Stomatology, Nanjing Medical University, 136 Hanzhong Road, Nanjing, Jiangsu 210029, ChinaInstitute of Stomatology, Nanjing Medical University, 136 Hanzhong Road, Nanjing, Jiangsu 210029, ChinaEndodontic Department, School of Stomatology, Nanjing Medical University, 136 Hanzhong Road, Nanjing, Jiangsu 210029, ChinaEndodontic Department, School of Stomatology, Nanjing Medical University, 136 Hanzhong Road, Nanjing, Jiangsu 210029, ChinaCenral Lab, First People’s Hospital of Wujiang Dist, Suzhou, Jiangsu, ChinaInstitute of Stomatology, Nanjing Medical University, 136 Hanzhong Road, Nanjing, Jiangsu 210029, ChinaInstitute of Stomatology, Nanjing Medical University, 136 Hanzhong Road, Nanjing, Jiangsu 210029, ChinaInstitute of Stomatology, Nanjing Medical University, 136 Hanzhong Road, Nanjing, Jiangsu 210029, ChinaDepartment of Histology and Embryology, Nanjing Medical University, 140 Hanzhong Road, Nanjing, Jiangsu 210029, ChinaEndodontic Department, School of Stomatology, Nanjing Medical University, 136 Hanzhong Road, Nanjing, Jiangsu 210029, ChinaThe calcined tooth powder (CTP), a type of allogeneic biomimetic mineralized material, has been confirmed that can promote new bone formation when obtained at high temperature. The aim of this study was to investigate effects of the conditioned medium of calcined tooth powder (CTP-CM) on the osteogenic and odontogenic differentiation of human dental pulp stem cells (hDPSCs) and the underlying mechanisms involved. First, ALP activity assay determined that 200 μg/mL was the optimal concentration of CTP-CM for the following experiments. CTP-CM had no significant effect on the proliferation of hDPSCs as indicated by CCK-8 and FCM analysis. Both the gene and protein (DSPP/DSPP, RUNX2/RUNX2, OCN/OCN, OSX/OSX, OPN/OPN, ALP/ALP, and COL-1/COL-1) expression levels increased in the CTP-CM-induced hDPSC group as compared with those in the control group at day 3 or 7, showing the positive regulation of CTP-CM on the osteo/odontogenic differentiation of hDPSCs. Mechanistically, MAPK signaling pathways were activated after the CTP-CM treatment, and the inhibitors targeting MAPK were identified which weakened the effects of CTM-CM on the committed differentiation of hDPSCs. These findings could lead to the creation of stem cell therapies for dental regeneration.http://dx.doi.org/10.1155/2019/4793518 |
| spellingShingle | Jintao Wu Na Li Yuan Fan Yanqiu Wang Yongchun Gu Zehan Li Yin Pan Gobin Romila Zuomin Zhou Jinhua Yu The Conditioned Medium of Calcined Tooth Powder Promotes the Osteogenic and Odontogenic Differentiation of Human Dental Pulp Stem Cells via MAPK Signaling Pathways Stem Cells International |
| title | The Conditioned Medium of Calcined Tooth Powder Promotes the Osteogenic and Odontogenic Differentiation of Human Dental Pulp Stem Cells via MAPK Signaling Pathways |
| title_full | The Conditioned Medium of Calcined Tooth Powder Promotes the Osteogenic and Odontogenic Differentiation of Human Dental Pulp Stem Cells via MAPK Signaling Pathways |
| title_fullStr | The Conditioned Medium of Calcined Tooth Powder Promotes the Osteogenic and Odontogenic Differentiation of Human Dental Pulp Stem Cells via MAPK Signaling Pathways |
| title_full_unstemmed | The Conditioned Medium of Calcined Tooth Powder Promotes the Osteogenic and Odontogenic Differentiation of Human Dental Pulp Stem Cells via MAPK Signaling Pathways |
| title_short | The Conditioned Medium of Calcined Tooth Powder Promotes the Osteogenic and Odontogenic Differentiation of Human Dental Pulp Stem Cells via MAPK Signaling Pathways |
| title_sort | conditioned medium of calcined tooth powder promotes the osteogenic and odontogenic differentiation of human dental pulp stem cells via mapk signaling pathways |
| url | http://dx.doi.org/10.1155/2019/4793518 |
| work_keys_str_mv | AT jintaowu theconditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT nali theconditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT yuanfan theconditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT yanqiuwang theconditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT yongchungu theconditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT zehanli theconditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT yinpan theconditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT gobinromila theconditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT zuominzhou theconditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT jinhuayu theconditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT jintaowu conditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT nali conditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT yuanfan conditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT yanqiuwang conditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT yongchungu conditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT zehanli conditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT yinpan conditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT gobinromila conditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT zuominzhou conditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways AT jinhuayu conditionedmediumofcalcinedtoothpowderpromotestheosteogenicandodontogenicdifferentiationofhumandentalpulpstemcellsviamapksignalingpathways |