Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China
Abstract The coastal ocean is the dynamic interface where terrestrial, atmospheric, and marine systems converge, acting as a hotspot for microbial activity, which underpins the intricate web of carbon and nitrogen cycling. Dapeng Bay, a typical semi-enclosed bay along the southern coastline of China...
Saved in:
| Main Authors: | , , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Nature Portfolio
2025-03-01
|
| Series: | Scientific Data |
| Online Access: | https://doi.org/10.1038/s41597-025-04669-7 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850252079407300608 |
|---|---|
| author | Yanwei Chen Siruo Chen Jianchang Tao Minxu Li Wenxiu Wang Mei Chen Xiaochen Fang Lingchao Kong Yidong Wang Olivier Pereira Chuanlun Zhang |
| author_facet | Yanwei Chen Siruo Chen Jianchang Tao Minxu Li Wenxiu Wang Mei Chen Xiaochen Fang Lingchao Kong Yidong Wang Olivier Pereira Chuanlun Zhang |
| author_sort | Yanwei Chen |
| collection | DOAJ |
| description | Abstract The coastal ocean is the dynamic interface where terrestrial, atmospheric, and marine systems converge, acting as a hotspot for microbial activity, which underpins the intricate web of carbon and nitrogen cycling. Dapeng Bay, a typical semi-enclosed bay along the southern coastline of China, is strongly influenced by monsoon climates and human activities. Despite its ecological importance, long-term observations and investigations into the microbial community structure in this region are notably lacking. To address this gap, we conducted a two-year continuous sampling from May 2021 to June 2023 to explore shifts in nearshore surface microbial communities and assess the long-term effects of environmental stressors. This study presents comprehensive amplicon, metagenomic, and metatranscriptomic information. We identified 3,600 amplicon sequence variants and recovered 1,216 high-quality metagenome-assembled MAGs, representing 17 bacterial and 3 archaeal phyla. Additionally, 587 MAGs were correlated with transcriptional activity, comprising 539 bacterial and 48 archaeal populations. This dataset is anticipated to provide a multi-dimensional perspective, enhancing our understanding of the complexity, dynamics, and adaptability of microbial communities in coastal environments. |
| format | Article |
| id | doaj-art-a667e84fe3fb4de084392dbdb0140341 |
| institution | OA Journals |
| issn | 2052-4463 |
| language | English |
| publishDate | 2025-03-01 |
| publisher | Nature Portfolio |
| record_format | Article |
| series | Scientific Data |
| spelling | doaj-art-a667e84fe3fb4de084392dbdb01403412025-08-20T01:57:44ZengNature PortfolioScientific Data2052-44632025-03-011211910.1038/s41597-025-04669-7Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, ChinaYanwei Chen0Siruo Chen1Jianchang Tao2Minxu Li3Wenxiu Wang4Mei Chen5Xiaochen Fang6Lingchao Kong7Yidong Wang8Olivier Pereira9Chuanlun Zhang10Shenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologySanya Institute of South China Sea Geology, Guangzhou Marine Geological SurveySanya Institute of South China Sea Geology, Guangzhou Marine Geological SurveyState Environmental Protection Key Laboratory of Integrated Surface Water-Groundwater Pollution Control, Guangdong Provincial Key Laboratory of Soil and Groundwater Pollution Control, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyAbstract The coastal ocean is the dynamic interface where terrestrial, atmospheric, and marine systems converge, acting as a hotspot for microbial activity, which underpins the intricate web of carbon and nitrogen cycling. Dapeng Bay, a typical semi-enclosed bay along the southern coastline of China, is strongly influenced by monsoon climates and human activities. Despite its ecological importance, long-term observations and investigations into the microbial community structure in this region are notably lacking. To address this gap, we conducted a two-year continuous sampling from May 2021 to June 2023 to explore shifts in nearshore surface microbial communities and assess the long-term effects of environmental stressors. This study presents comprehensive amplicon, metagenomic, and metatranscriptomic information. We identified 3,600 amplicon sequence variants and recovered 1,216 high-quality metagenome-assembled MAGs, representing 17 bacterial and 3 archaeal phyla. Additionally, 587 MAGs were correlated with transcriptional activity, comprising 539 bacterial and 48 archaeal populations. This dataset is anticipated to provide a multi-dimensional perspective, enhancing our understanding of the complexity, dynamics, and adaptability of microbial communities in coastal environments.https://doi.org/10.1038/s41597-025-04669-7 |
| spellingShingle | Yanwei Chen Siruo Chen Jianchang Tao Minxu Li Wenxiu Wang Mei Chen Xiaochen Fang Lingchao Kong Yidong Wang Olivier Pereira Chuanlun Zhang Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China Scientific Data |
| title | Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China |
| title_full | Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China |
| title_fullStr | Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China |
| title_full_unstemmed | Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China |
| title_short | Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China |
| title_sort | multi omic stock of surface ocean microbiome built by monthly weekly and daily sampling in dapeng bay china |
| url | https://doi.org/10.1038/s41597-025-04669-7 |
| work_keys_str_mv | AT yanweichen multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina AT siruochen multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina AT jianchangtao multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina AT minxuli multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina AT wenxiuwang multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina AT meichen multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina AT xiaochenfang multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina AT lingchaokong multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina AT yidongwang multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina AT olivierpereira multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina AT chuanlunzhang multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina |