Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China

Abstract The coastal ocean is the dynamic interface where terrestrial, atmospheric, and marine systems converge, acting as a hotspot for microbial activity, which underpins the intricate web of carbon and nitrogen cycling. Dapeng Bay, a typical semi-enclosed bay along the southern coastline of China...

Full description

Saved in:
Bibliographic Details
Main Authors: Yanwei Chen, Siruo Chen, Jianchang Tao, Minxu Li, Wenxiu Wang, Mei Chen, Xiaochen Fang, Lingchao Kong, Yidong Wang, Olivier Pereira, Chuanlun Zhang
Format: Article
Language:English
Published: Nature Portfolio 2025-03-01
Series:Scientific Data
Online Access:https://doi.org/10.1038/s41597-025-04669-7
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850252079407300608
author Yanwei Chen
Siruo Chen
Jianchang Tao
Minxu Li
Wenxiu Wang
Mei Chen
Xiaochen Fang
Lingchao Kong
Yidong Wang
Olivier Pereira
Chuanlun Zhang
author_facet Yanwei Chen
Siruo Chen
Jianchang Tao
Minxu Li
Wenxiu Wang
Mei Chen
Xiaochen Fang
Lingchao Kong
Yidong Wang
Olivier Pereira
Chuanlun Zhang
author_sort Yanwei Chen
collection DOAJ
description Abstract The coastal ocean is the dynamic interface where terrestrial, atmospheric, and marine systems converge, acting as a hotspot for microbial activity, which underpins the intricate web of carbon and nitrogen cycling. Dapeng Bay, a typical semi-enclosed bay along the southern coastline of China, is strongly influenced by monsoon climates and human activities. Despite its ecological importance, long-term observations and investigations into the microbial community structure in this region are notably lacking. To address this gap, we conducted a two-year continuous sampling from May 2021 to June 2023 to explore shifts in nearshore surface microbial communities and assess the long-term effects of environmental stressors. This study presents comprehensive amplicon, metagenomic, and metatranscriptomic information. We identified 3,600 amplicon sequence variants and recovered 1,216 high-quality metagenome-assembled MAGs, representing 17 bacterial and 3 archaeal phyla. Additionally, 587 MAGs were correlated with transcriptional activity, comprising 539 bacterial and 48 archaeal populations. This dataset is anticipated to provide a multi-dimensional perspective, enhancing our understanding of the complexity, dynamics, and adaptability of microbial communities in coastal environments.
format Article
id doaj-art-a667e84fe3fb4de084392dbdb0140341
institution OA Journals
issn 2052-4463
language English
publishDate 2025-03-01
publisher Nature Portfolio
record_format Article
series Scientific Data
spelling doaj-art-a667e84fe3fb4de084392dbdb01403412025-08-20T01:57:44ZengNature PortfolioScientific Data2052-44632025-03-011211910.1038/s41597-025-04669-7Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, ChinaYanwei Chen0Siruo Chen1Jianchang Tao2Minxu Li3Wenxiu Wang4Mei Chen5Xiaochen Fang6Lingchao Kong7Yidong Wang8Olivier Pereira9Chuanlun Zhang10Shenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologySanya Institute of South China Sea Geology, Guangzhou Marine Geological SurveySanya Institute of South China Sea Geology, Guangzhou Marine Geological SurveyState Environmental Protection Key Laboratory of Integrated Surface Water-Groundwater Pollution Control, Guangdong Provincial Key Laboratory of Soil and Groundwater Pollution Control, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyShenzhen Key Laboratory of Marine Archaea Geo-Omics, Department of Ocean Science and Engineering, Southern University of Science and TechnologyAbstract The coastal ocean is the dynamic interface where terrestrial, atmospheric, and marine systems converge, acting as a hotspot for microbial activity, which underpins the intricate web of carbon and nitrogen cycling. Dapeng Bay, a typical semi-enclosed bay along the southern coastline of China, is strongly influenced by monsoon climates and human activities. Despite its ecological importance, long-term observations and investigations into the microbial community structure in this region are notably lacking. To address this gap, we conducted a two-year continuous sampling from May 2021 to June 2023 to explore shifts in nearshore surface microbial communities and assess the long-term effects of environmental stressors. This study presents comprehensive amplicon, metagenomic, and metatranscriptomic information. We identified 3,600 amplicon sequence variants and recovered 1,216 high-quality metagenome-assembled MAGs, representing 17 bacterial and 3 archaeal phyla. Additionally, 587 MAGs were correlated with transcriptional activity, comprising 539 bacterial and 48 archaeal populations. This dataset is anticipated to provide a multi-dimensional perspective, enhancing our understanding of the complexity, dynamics, and adaptability of microbial communities in coastal environments.https://doi.org/10.1038/s41597-025-04669-7
spellingShingle Yanwei Chen
Siruo Chen
Jianchang Tao
Minxu Li
Wenxiu Wang
Mei Chen
Xiaochen Fang
Lingchao Kong
Yidong Wang
Olivier Pereira
Chuanlun Zhang
Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China
Scientific Data
title Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China
title_full Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China
title_fullStr Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China
title_full_unstemmed Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China
title_short Multi-omic stock of surface ocean microbiome built by monthly, weekly and daily sampling in Dapeng Bay, China
title_sort multi omic stock of surface ocean microbiome built by monthly weekly and daily sampling in dapeng bay china
url https://doi.org/10.1038/s41597-025-04669-7
work_keys_str_mv AT yanweichen multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina
AT siruochen multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina
AT jianchangtao multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina
AT minxuli multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina
AT wenxiuwang multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina
AT meichen multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina
AT xiaochenfang multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina
AT lingchaokong multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina
AT yidongwang multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina
AT olivierpereira multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina
AT chuanlunzhang multiomicstockofsurfaceoceanmicrobiomebuiltbymonthlyweeklyanddailysamplingindapengbaychina