Nicotinamide Mononucleotide Restores NAD<sup>+</sup> Levels to Alleviate LPS-Induced Inflammation via the TLR4/NF-κB/MAPK Signaling Pathway in Mice Granulosa Cells
Inflammation disrupts the normal function of granulosa cells (GCs), which leads to ovarian dysfunction and fertility decline. Inflammatory conditions such as polycystic ovary syndrome (PCOS), primary ovarian insufficiency (POI), endometriosis, and age-related ovarian decline are often associated wit...
Saved in:
| Main Authors: | , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2024-12-01
|
| Series: | Antioxidants |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2076-3921/14/1/39 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832589347447111680 |
|---|---|
| author | Mehboob Ahmed Umair Riaz Haimiao Lv Muhammad Amjad Sohail Ahmed Shaokat Ali Muhammad Usman Ghani Guohua Hua Liguo Yang |
| author_facet | Mehboob Ahmed Umair Riaz Haimiao Lv Muhammad Amjad Sohail Ahmed Shaokat Ali Muhammad Usman Ghani Guohua Hua Liguo Yang |
| author_sort | Mehboob Ahmed |
| collection | DOAJ |
| description | Inflammation disrupts the normal function of granulosa cells (GCs), which leads to ovarian dysfunction and fertility decline. Inflammatory conditions such as polycystic ovary syndrome (PCOS), primary ovarian insufficiency (POI), endometriosis, and age-related ovarian decline are often associated with chronic low-grade inflammation. Nicotinamide mononucleotide (NMN) is an important precursor of NAD<sup>+</sup> and has gained attention for its potential to modulate cellular metabolism, redox homeostasis, and mitigate inflammation. This study investigated the protective roles of NMN against lipopolysaccharide LPS-mediated inflammation in GCs. The results of this experiment demonstrated that LPS had negative effects on GCs in term of reduced viability and proliferation rates and upregulated the production of pro-inflammatory cytokines, including interleukin-1 beta (IL-1β), interleukin-6 (IL-6), cyclooxygenase-2 (Cox-2), and tumor necrosis factor-alpha (TNF-α). Notably, the levels of NAD<sup>+</sup> and NAD<sup>+</sup>/NADH ratio in GCs were reduced in response to inflammation. On the other hand, NMN supplementation restored the NAD<sup>+</sup> levels and the NAD<sup>+</sup>/NADH ratio in GCs and significantly reduced the expression of pro-inflammatory markers at both mRNA and protein levels. It also enhanced cell viability and proliferation rates of GCs. Furthermore, NMN also reduced apoptosis rates in GCs by downregulating pro-apoptotic markers, including Caspase-3, Caspase-9, and Bax while upregulating anti-apoptotic marker Bcl-2. NMN supplementation significantly reduced reactive oxygen species ROS and improved steroidogenesis activity by restoring the estradiol (E2) and progesterone (P4) levels in LPS-treated GCs. Mechanistically, this study found that NMN suppressed the activation of the TLR4/NF-κB/MAPK signaling pathways in GCs, which regulates inflammatory processes. In conclusion, the findings of this study revealed that NMN has the potential to reduce LPS-mediated inflammatory changes in GCs by modulating NAD<sup>+</sup> metabolism and inflammatory signaling pathways. NMN supplementation can be used as a potential therapeutic agent for ovarian inflammation and related fertility disorders. |
| format | Article |
| id | doaj-art-a5559e561b5a4b8e90a2f93289ce14bc |
| institution | Kabale University |
| issn | 2076-3921 |
| language | English |
| publishDate | 2024-12-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Antioxidants |
| spelling | doaj-art-a5559e561b5a4b8e90a2f93289ce14bc2025-01-24T13:19:15ZengMDPI AGAntioxidants2076-39212024-12-011413910.3390/antiox14010039Nicotinamide Mononucleotide Restores NAD<sup>+</sup> Levels to Alleviate LPS-Induced Inflammation via the TLR4/NF-κB/MAPK Signaling Pathway in Mice Granulosa CellsMehboob Ahmed0Umair Riaz1Haimiao Lv2Muhammad Amjad3Sohail Ahmed4Shaokat Ali5Muhammad Usman Ghani6Guohua Hua7Liguo Yang8Hubei Hongshan Laboratory, Wuhan 430070, ChinaHubei Hongshan Laboratory, Wuhan 430070, ChinaHubei Hongshan Laboratory, Wuhan 430070, ChinaHubei Hongshan Laboratory, Wuhan 430070, ChinaKey Laboratory of Agricultural Animal Genetics, Breeding and Reproduction of Ministry of Education, College of Animal Science and Technology, Huazhong Agricultural University, Wuhan 430070, ChinaKey Laboratory of Agricultural Animal Genetics, Breeding and Reproduction of Ministry of Education, College of Animal Science and Technology, Huazhong Agricultural University, Wuhan 430070, ChinaMedical Research Institute, Southwest University, Chongqing 400715, ChinaHubei Hongshan Laboratory, Wuhan 430070, ChinaHubei Hongshan Laboratory, Wuhan 430070, ChinaInflammation disrupts the normal function of granulosa cells (GCs), which leads to ovarian dysfunction and fertility decline. Inflammatory conditions such as polycystic ovary syndrome (PCOS), primary ovarian insufficiency (POI), endometriosis, and age-related ovarian decline are often associated with chronic low-grade inflammation. Nicotinamide mononucleotide (NMN) is an important precursor of NAD<sup>+</sup> and has gained attention for its potential to modulate cellular metabolism, redox homeostasis, and mitigate inflammation. This study investigated the protective roles of NMN against lipopolysaccharide LPS-mediated inflammation in GCs. The results of this experiment demonstrated that LPS had negative effects on GCs in term of reduced viability and proliferation rates and upregulated the production of pro-inflammatory cytokines, including interleukin-1 beta (IL-1β), interleukin-6 (IL-6), cyclooxygenase-2 (Cox-2), and tumor necrosis factor-alpha (TNF-α). Notably, the levels of NAD<sup>+</sup> and NAD<sup>+</sup>/NADH ratio in GCs were reduced in response to inflammation. On the other hand, NMN supplementation restored the NAD<sup>+</sup> levels and the NAD<sup>+</sup>/NADH ratio in GCs and significantly reduced the expression of pro-inflammatory markers at both mRNA and protein levels. It also enhanced cell viability and proliferation rates of GCs. Furthermore, NMN also reduced apoptosis rates in GCs by downregulating pro-apoptotic markers, including Caspase-3, Caspase-9, and Bax while upregulating anti-apoptotic marker Bcl-2. NMN supplementation significantly reduced reactive oxygen species ROS and improved steroidogenesis activity by restoring the estradiol (E2) and progesterone (P4) levels in LPS-treated GCs. Mechanistically, this study found that NMN suppressed the activation of the TLR4/NF-κB/MAPK signaling pathways in GCs, which regulates inflammatory processes. In conclusion, the findings of this study revealed that NMN has the potential to reduce LPS-mediated inflammatory changes in GCs by modulating NAD<sup>+</sup> metabolism and inflammatory signaling pathways. NMN supplementation can be used as a potential therapeutic agent for ovarian inflammation and related fertility disorders.https://www.mdpi.com/2076-3921/14/1/39granulosa cellNMNNAD<sup>+</sup>inflammationapoptosisROS |
| spellingShingle | Mehboob Ahmed Umair Riaz Haimiao Lv Muhammad Amjad Sohail Ahmed Shaokat Ali Muhammad Usman Ghani Guohua Hua Liguo Yang Nicotinamide Mononucleotide Restores NAD<sup>+</sup> Levels to Alleviate LPS-Induced Inflammation via the TLR4/NF-κB/MAPK Signaling Pathway in Mice Granulosa Cells Antioxidants granulosa cell NMN NAD<sup>+</sup> inflammation apoptosis ROS |
| title | Nicotinamide Mononucleotide Restores NAD<sup>+</sup> Levels to Alleviate LPS-Induced Inflammation via the TLR4/NF-κB/MAPK Signaling Pathway in Mice Granulosa Cells |
| title_full | Nicotinamide Mononucleotide Restores NAD<sup>+</sup> Levels to Alleviate LPS-Induced Inflammation via the TLR4/NF-κB/MAPK Signaling Pathway in Mice Granulosa Cells |
| title_fullStr | Nicotinamide Mononucleotide Restores NAD<sup>+</sup> Levels to Alleviate LPS-Induced Inflammation via the TLR4/NF-κB/MAPK Signaling Pathway in Mice Granulosa Cells |
| title_full_unstemmed | Nicotinamide Mononucleotide Restores NAD<sup>+</sup> Levels to Alleviate LPS-Induced Inflammation via the TLR4/NF-κB/MAPK Signaling Pathway in Mice Granulosa Cells |
| title_short | Nicotinamide Mononucleotide Restores NAD<sup>+</sup> Levels to Alleviate LPS-Induced Inflammation via the TLR4/NF-κB/MAPK Signaling Pathway in Mice Granulosa Cells |
| title_sort | nicotinamide mononucleotide restores nad sup sup levels to alleviate lps induced inflammation via the tlr4 nf κb mapk signaling pathway in mice granulosa cells |
| topic | granulosa cell NMN NAD<sup>+</sup> inflammation apoptosis ROS |
| url | https://www.mdpi.com/2076-3921/14/1/39 |
| work_keys_str_mv | AT mehboobahmed nicotinamidemononucleotiderestoresnadsupsuplevelstoalleviatelpsinducedinflammationviathetlr4nfkbmapksignalingpathwayinmicegranulosacells AT umairriaz nicotinamidemononucleotiderestoresnadsupsuplevelstoalleviatelpsinducedinflammationviathetlr4nfkbmapksignalingpathwayinmicegranulosacells AT haimiaolv nicotinamidemononucleotiderestoresnadsupsuplevelstoalleviatelpsinducedinflammationviathetlr4nfkbmapksignalingpathwayinmicegranulosacells AT muhammadamjad nicotinamidemononucleotiderestoresnadsupsuplevelstoalleviatelpsinducedinflammationviathetlr4nfkbmapksignalingpathwayinmicegranulosacells AT sohailahmed nicotinamidemononucleotiderestoresnadsupsuplevelstoalleviatelpsinducedinflammationviathetlr4nfkbmapksignalingpathwayinmicegranulosacells AT shaokatali nicotinamidemononucleotiderestoresnadsupsuplevelstoalleviatelpsinducedinflammationviathetlr4nfkbmapksignalingpathwayinmicegranulosacells AT muhammadusmanghani nicotinamidemononucleotiderestoresnadsupsuplevelstoalleviatelpsinducedinflammationviathetlr4nfkbmapksignalingpathwayinmicegranulosacells AT guohuahua nicotinamidemononucleotiderestoresnadsupsuplevelstoalleviatelpsinducedinflammationviathetlr4nfkbmapksignalingpathwayinmicegranulosacells AT liguoyang nicotinamidemononucleotiderestoresnadsupsuplevelstoalleviatelpsinducedinflammationviathetlr4nfkbmapksignalingpathwayinmicegranulosacells |