Iron- Refractory Iron Deficiency Anemia: Review Article
Background: IRIDA is an inherited recessive anaemia caused by a defect in the TMPRSS6 gene, which codes for the enzyme matriptase-2. This transmembrane serine protease suppresses hepcidin production, an iron regulator (suppressing intestinal absorption of iron). The biochemical results include norma...
Saved in:
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
South Valley University, Faculty of Medicine
2024-07-01
|
| Series: | SVU - International Journal of Medical Sciences |
| Subjects: | |
| Online Access: | https://svuijm.journals.ekb.eg/article_356848.html |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832590623803179008 |
|---|---|
| author | Eman Ahmed Abd -Elmawgood Mohammed H. Hassan Dina Hussein Mobark Nagwan Ibrahim Rashwan |
| author_facet | Eman Ahmed Abd -Elmawgood Mohammed H. Hassan Dina Hussein Mobark Nagwan Ibrahim Rashwan |
| author_sort | Eman Ahmed Abd -Elmawgood |
| collection | DOAJ |
| description | Background: IRIDA is an inherited recessive anaemia caused by a defect in the TMPRSS6 gene, which codes for the enzyme matriptase-2. This transmembrane serine protease suppresses hepcidin production, an iron regulator (suppressing intestinal absorption of iron). The biochemical results include normal to elevated hepcidin levels, inadequate transferrin saturation, and microcytic hypochromic anaemia. Although it can be identified at a later time, anaemia often manifests after birth. Despite the fact that effectiveness of oral iron therapy can depend on the degree of TMPRSS6 gene mutation. There are other therapies that either partially or totally correct anaemia such as intravenous iron infusions ,liposomal oral iron therapy ,anti hepcidin antibody and other information discussed later in these article .
Objectives: to examine IRIDA's genesis, diagnosis, and therapy.
Conclusion: When diagnosing microcytic anaemia, it is important to consider the separate disease entity known as iron refractory iron deficiency anaemia. |
| format | Article |
| id | doaj-art-a5246dfcc2c642669a611e2ef6f56aa6 |
| institution | Kabale University |
| issn | 2735-427X 2636-3402 |
| language | English |
| publishDate | 2024-07-01 |
| publisher | South Valley University, Faculty of Medicine |
| record_format | Article |
| series | SVU - International Journal of Medical Sciences |
| spelling | doaj-art-a5246dfcc2c642669a611e2ef6f56aa62025-01-23T09:36:00ZengSouth Valley University, Faculty of MedicineSVU - International Journal of Medical Sciences2735-427X2636-34022024-07-0172917https://doi.org/10.21608/svuijm.2022.165086.1417Iron- Refractory Iron Deficiency Anemia: Review ArticleEman Ahmed Abd -Elmawgood 0 Mohammed H. Hassan 1Dina Hussein Mobark 2Nagwan Ibrahim Rashwan3Department of Pediatrics, Faculty of Medicine, South Valley University, Qena, Egypt.Department of Medical Biochemistry, Faculty of Medicine, South Valley University, Qena, Egypt.Department of Pediatrics, Faculty of Medicine, South Valley University, Qena, Egypt.Department of Pediatrics, Faculty of Medicine, South Valley University, Qena, Egypt.Background: IRIDA is an inherited recessive anaemia caused by a defect in the TMPRSS6 gene, which codes for the enzyme matriptase-2. This transmembrane serine protease suppresses hepcidin production, an iron regulator (suppressing intestinal absorption of iron). The biochemical results include normal to elevated hepcidin levels, inadequate transferrin saturation, and microcytic hypochromic anaemia. Although it can be identified at a later time, anaemia often manifests after birth. Despite the fact that effectiveness of oral iron therapy can depend on the degree of TMPRSS6 gene mutation. There are other therapies that either partially or totally correct anaemia such as intravenous iron infusions ,liposomal oral iron therapy ,anti hepcidin antibody and other information discussed later in these article . Objectives: to examine IRIDA's genesis, diagnosis, and therapy. Conclusion: When diagnosing microcytic anaemia, it is important to consider the separate disease entity known as iron refractory iron deficiency anaemia.https://svuijm.journals.ekb.eg/article_356848.htmliron refractory iron deficiency anaemia(irida) idairon deficiency hepcidin |
| spellingShingle | Eman Ahmed Abd -Elmawgood Mohammed H. Hassan Dina Hussein Mobark Nagwan Ibrahim Rashwan Iron- Refractory Iron Deficiency Anemia: Review Article SVU - International Journal of Medical Sciences iron refractory iron deficiency anaemia(irida) ida iron deficiency hepcidin |
| title | Iron- Refractory Iron Deficiency Anemia: Review Article |
| title_full | Iron- Refractory Iron Deficiency Anemia: Review Article |
| title_fullStr | Iron- Refractory Iron Deficiency Anemia: Review Article |
| title_full_unstemmed | Iron- Refractory Iron Deficiency Anemia: Review Article |
| title_short | Iron- Refractory Iron Deficiency Anemia: Review Article |
| title_sort | iron refractory iron deficiency anemia review article |
| topic | iron refractory iron deficiency anaemia(irida) ida iron deficiency hepcidin |
| url | https://svuijm.journals.ekb.eg/article_356848.html |
| work_keys_str_mv | AT emanahmedabdelmawgood ironrefractoryirondeficiencyanemiareviewarticle AT mohammedhhassan ironrefractoryirondeficiencyanemiareviewarticle AT dinahusseinmobark ironrefractoryirondeficiencyanemiareviewarticle AT nagwanibrahimrashwan ironrefractoryirondeficiencyanemiareviewarticle |