Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium
2-Arylethylamines are presented in several natural bioactive compounds, as well as in nitrogen-containing drugs. Their ability to surpass the blood–brain barrier makes this family of compounds of especial interest in medicinal chemistry. Asymmetric methodologies towards the synthesis of 2-arylethyla...
Saved in:
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2024-12-01
|
| Series: | Molecules |
| Subjects: | |
| Online Access: | https://www.mdpi.com/1420-3049/29/23/5729 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850060151631904768 |
|---|---|
| author | Alejandro Manchado Ángel García-González Carlos T. Nieto David Díez Narciso M. Garrido |
| author_facet | Alejandro Manchado Ángel García-González Carlos T. Nieto David Díez Narciso M. Garrido |
| author_sort | Alejandro Manchado |
| collection | DOAJ |
| description | 2-Arylethylamines are presented in several natural bioactive compounds, as well as in nitrogen-containing drugs. Their ability to surpass the blood–brain barrier makes this family of compounds of especial interest in medicinal chemistry. Asymmetric methodologies towards the synthesis of 2-arylethylamine motives are of great interest due to the challenges they may present. Thus, a concise metal-free review presenting recent advances in the asymmetric synthesis of 2-arylethylamines is presented, covering last-millennium studies, considering different methodologies towards the aforementioned motif, including chiral induction, organocatalysis, organophotocatalysis and enzymatic catalysis. |
| format | Article |
| id | doaj-art-997d93d3ec69407f8600d213dbddfbec |
| institution | DOAJ |
| issn | 1420-3049 |
| language | English |
| publishDate | 2024-12-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Molecules |
| spelling | doaj-art-997d93d3ec69407f8600d213dbddfbec2025-08-20T02:50:40ZengMDPI AGMolecules1420-30492024-12-012923572910.3390/molecules29235729Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New MillenniumAlejandro Manchado0Ángel García-González1Carlos T. Nieto2David Díez3Narciso M. Garrido4Department of Organic Chemistry, Faculty of Chemical Sciences, University of Salamanca, Pl. Caídos, s/n, 37008 Salamanca, SpainDepartment of Organic Chemistry, Faculty of Chemical Sciences, University of Salamanca, Pl. Caídos, s/n, 37008 Salamanca, SpainDepartment of Organic Chemistry, Faculty of Chemical Sciences, University of Salamanca, Pl. Caídos, s/n, 37008 Salamanca, SpainDepartment of Organic Chemistry, Faculty of Chemical Sciences, University of Salamanca, Pl. Caídos, s/n, 37008 Salamanca, SpainDepartment of Organic Chemistry, Faculty of Chemical Sciences, University of Salamanca, Pl. Caídos, s/n, 37008 Salamanca, Spain2-Arylethylamines are presented in several natural bioactive compounds, as well as in nitrogen-containing drugs. Their ability to surpass the blood–brain barrier makes this family of compounds of especial interest in medicinal chemistry. Asymmetric methodologies towards the synthesis of 2-arylethylamine motives are of great interest due to the challenges they may present. Thus, a concise metal-free review presenting recent advances in the asymmetric synthesis of 2-arylethylamines is presented, covering last-millennium studies, considering different methodologies towards the aforementioned motif, including chiral induction, organocatalysis, organophotocatalysis and enzymatic catalysis.https://www.mdpi.com/1420-3049/29/23/57292-phenethylamine2-arylethylamineasymmetric synthesischiral inductionorganocatalysisorganophotocatalysis |
| spellingShingle | Alejandro Manchado Ángel García-González Carlos T. Nieto David Díez Narciso M. Garrido Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium Molecules 2-phenethylamine 2-arylethylamine asymmetric synthesis chiral induction organocatalysis organophotocatalysis |
| title | Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium |
| title_full | Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium |
| title_fullStr | Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium |
| title_full_unstemmed | Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium |
| title_short | Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium |
| title_sort | asymmetric synthesis of 2 arylethylamines a metal free review of the new millennium |
| topic | 2-phenethylamine 2-arylethylamine asymmetric synthesis chiral induction organocatalysis organophotocatalysis |
| url | https://www.mdpi.com/1420-3049/29/23/5729 |
| work_keys_str_mv | AT alejandromanchado asymmetricsynthesisof2arylethylaminesametalfreereviewofthenewmillennium AT angelgarciagonzalez asymmetricsynthesisof2arylethylaminesametalfreereviewofthenewmillennium AT carlostnieto asymmetricsynthesisof2arylethylaminesametalfreereviewofthenewmillennium AT daviddiez asymmetricsynthesisof2arylethylaminesametalfreereviewofthenewmillennium AT narcisomgarrido asymmetricsynthesisof2arylethylaminesametalfreereviewofthenewmillennium |