Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium

2-Arylethylamines are presented in several natural bioactive compounds, as well as in nitrogen-containing drugs. Their ability to surpass the blood–brain barrier makes this family of compounds of especial interest in medicinal chemistry. Asymmetric methodologies towards the synthesis of 2-arylethyla...

Full description

Saved in:
Bibliographic Details
Main Authors: Alejandro Manchado, Ángel García-González, Carlos T. Nieto, David Díez, Narciso M. Garrido
Format: Article
Language:English
Published: MDPI AG 2024-12-01
Series:Molecules
Subjects:
Online Access:https://www.mdpi.com/1420-3049/29/23/5729
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850060151631904768
author Alejandro Manchado
Ángel García-González
Carlos T. Nieto
David Díez
Narciso M. Garrido
author_facet Alejandro Manchado
Ángel García-González
Carlos T. Nieto
David Díez
Narciso M. Garrido
author_sort Alejandro Manchado
collection DOAJ
description 2-Arylethylamines are presented in several natural bioactive compounds, as well as in nitrogen-containing drugs. Their ability to surpass the blood–brain barrier makes this family of compounds of especial interest in medicinal chemistry. Asymmetric methodologies towards the synthesis of 2-arylethylamine motives are of great interest due to the challenges they may present. Thus, a concise metal-free review presenting recent advances in the asymmetric synthesis of 2-arylethylamines is presented, covering last-millennium studies, considering different methodologies towards the aforementioned motif, including chiral induction, organocatalysis, organophotocatalysis and enzymatic catalysis.
format Article
id doaj-art-997d93d3ec69407f8600d213dbddfbec
institution DOAJ
issn 1420-3049
language English
publishDate 2024-12-01
publisher MDPI AG
record_format Article
series Molecules
spelling doaj-art-997d93d3ec69407f8600d213dbddfbec2025-08-20T02:50:40ZengMDPI AGMolecules1420-30492024-12-012923572910.3390/molecules29235729Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New MillenniumAlejandro Manchado0Ángel García-González1Carlos T. Nieto2David Díez3Narciso M. Garrido4Department of Organic Chemistry, Faculty of Chemical Sciences, University of Salamanca, Pl. Caídos, s/n, 37008 Salamanca, SpainDepartment of Organic Chemistry, Faculty of Chemical Sciences, University of Salamanca, Pl. Caídos, s/n, 37008 Salamanca, SpainDepartment of Organic Chemistry, Faculty of Chemical Sciences, University of Salamanca, Pl. Caídos, s/n, 37008 Salamanca, SpainDepartment of Organic Chemistry, Faculty of Chemical Sciences, University of Salamanca, Pl. Caídos, s/n, 37008 Salamanca, SpainDepartment of Organic Chemistry, Faculty of Chemical Sciences, University of Salamanca, Pl. Caídos, s/n, 37008 Salamanca, Spain2-Arylethylamines are presented in several natural bioactive compounds, as well as in nitrogen-containing drugs. Their ability to surpass the blood–brain barrier makes this family of compounds of especial interest in medicinal chemistry. Asymmetric methodologies towards the synthesis of 2-arylethylamine motives are of great interest due to the challenges they may present. Thus, a concise metal-free review presenting recent advances in the asymmetric synthesis of 2-arylethylamines is presented, covering last-millennium studies, considering different methodologies towards the aforementioned motif, including chiral induction, organocatalysis, organophotocatalysis and enzymatic catalysis.https://www.mdpi.com/1420-3049/29/23/57292-phenethylamine2-arylethylamineasymmetric synthesischiral inductionorganocatalysisorganophotocatalysis
spellingShingle Alejandro Manchado
Ángel García-González
Carlos T. Nieto
David Díez
Narciso M. Garrido
Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium
Molecules
2-phenethylamine
2-arylethylamine
asymmetric synthesis
chiral induction
organocatalysis
organophotocatalysis
title Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium
title_full Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium
title_fullStr Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium
title_full_unstemmed Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium
title_short Asymmetric Synthesis of 2-Arylethylamines: A Metal-Free Review of the New Millennium
title_sort asymmetric synthesis of 2 arylethylamines a metal free review of the new millennium
topic 2-phenethylamine
2-arylethylamine
asymmetric synthesis
chiral induction
organocatalysis
organophotocatalysis
url https://www.mdpi.com/1420-3049/29/23/5729
work_keys_str_mv AT alejandromanchado asymmetricsynthesisof2arylethylaminesametalfreereviewofthenewmillennium
AT angelgarciagonzalez asymmetricsynthesisof2arylethylaminesametalfreereviewofthenewmillennium
AT carlostnieto asymmetricsynthesisof2arylethylaminesametalfreereviewofthenewmillennium
AT daviddiez asymmetricsynthesisof2arylethylaminesametalfreereviewofthenewmillennium
AT narcisomgarrido asymmetricsynthesisof2arylethylaminesametalfreereviewofthenewmillennium