Gene Expression Profiling Identifies Downregulation of the Neurotrophin-MAPK Signaling Pathway in Female Diabetic Peripheral Neuropathy Patients
Diabetic peripheral neuropathy (DPN) is a common complication of diabetes mellitus (DM). It is not diagnosed or managed properly in the majority of patients because its pathogenesis remains controversial. In this study, human whole genome microarrays identified 2898 and 4493 differentially expressed...
Saved in:
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2017-01-01
|
| Series: | Journal of Diabetes Research |
| Online Access: | http://dx.doi.org/10.1155/2017/8103904 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832567320583602176 |
|---|---|
| author | Lin Luo Wen-Hua Zhou Jiang-Jia Cai Mei Feng Mi Zhou Su-Pei Hu Jin Xu Lin-Dan Ji |
| author_facet | Lin Luo Wen-Hua Zhou Jiang-Jia Cai Mei Feng Mi Zhou Su-Pei Hu Jin Xu Lin-Dan Ji |
| author_sort | Lin Luo |
| collection | DOAJ |
| description | Diabetic peripheral neuropathy (DPN) is a common complication of diabetes mellitus (DM). It is not diagnosed or managed properly in the majority of patients because its pathogenesis remains controversial. In this study, human whole genome microarrays identified 2898 and 4493 differentially expressed genes (DEGs) in DM and DPN patients, respectively. A further KEGG pathway analysis indicated that DPN and DM share four pathways, including apoptosis, B cell receptor signaling pathway, endocytosis, and Toll-like receptor signaling pathway. The DEGs identified through comparison of DPN and DM were significantly enriched in MAPK signaling pathway, NOD-like receptor signaling pathway, and neurotrophin signaling pathway, while the “neurotrophin-MAPK signaling pathway” was notably downregulated. Seven DEGs from the neurotrophin-MAPK signaling pathway were validated in additional 78 samples, and the results confirmed the initial microarray findings. These findings demonstrated that downregulation of the neurotrophin-MAPK signaling pathway may be the major mechanism of DPN pathogenesis, thus providing a potential approach for DPN treatment. |
| format | Article |
| id | doaj-art-9510d8272bc344159e48ba9c8d64b12b |
| institution | Kabale University |
| issn | 2314-6745 2314-6753 |
| language | English |
| publishDate | 2017-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | Journal of Diabetes Research |
| spelling | doaj-art-9510d8272bc344159e48ba9c8d64b12b2025-02-03T01:01:52ZengWileyJournal of Diabetes Research2314-67452314-67532017-01-01201710.1155/2017/81039048103904Gene Expression Profiling Identifies Downregulation of the Neurotrophin-MAPK Signaling Pathway in Female Diabetic Peripheral Neuropathy PatientsLin Luo0Wen-Hua Zhou1Jiang-Jia Cai2Mei Feng3Mi Zhou4Su-Pei Hu5Jin Xu6Lin-Dan Ji7Zhejiang Key Laboratory of Pathophysiology, Medical School of Ningbo University, Ningbo 315211, ChinaLaboratory of Behavioral Neuroscience, Ningbo Addiction Research and Treatment Center, Medical School of Ningbo University, Ningbo 315211, ChinaZhejiang Key Laboratory of Pathophysiology, Medical School of Ningbo University, Ningbo 315211, ChinaDepartment of Preventive Medicine, Medical School of Ningbo University, Ningbo 315211, ChinaDepartment of Preventive Medicine, Medical School of Ningbo University, Ningbo 315211, ChinaDepartment of Research and Teaching, Ningbo No. 2 Hospital, Ningbo 315010, ChinaZhejiang Key Laboratory of Pathophysiology, Medical School of Ningbo University, Ningbo 315211, ChinaZhejiang Key Laboratory of Pathophysiology, Medical School of Ningbo University, Ningbo 315211, ChinaDiabetic peripheral neuropathy (DPN) is a common complication of diabetes mellitus (DM). It is not diagnosed or managed properly in the majority of patients because its pathogenesis remains controversial. In this study, human whole genome microarrays identified 2898 and 4493 differentially expressed genes (DEGs) in DM and DPN patients, respectively. A further KEGG pathway analysis indicated that DPN and DM share four pathways, including apoptosis, B cell receptor signaling pathway, endocytosis, and Toll-like receptor signaling pathway. The DEGs identified through comparison of DPN and DM were significantly enriched in MAPK signaling pathway, NOD-like receptor signaling pathway, and neurotrophin signaling pathway, while the “neurotrophin-MAPK signaling pathway” was notably downregulated. Seven DEGs from the neurotrophin-MAPK signaling pathway were validated in additional 78 samples, and the results confirmed the initial microarray findings. These findings demonstrated that downregulation of the neurotrophin-MAPK signaling pathway may be the major mechanism of DPN pathogenesis, thus providing a potential approach for DPN treatment.http://dx.doi.org/10.1155/2017/8103904 |
| spellingShingle | Lin Luo Wen-Hua Zhou Jiang-Jia Cai Mei Feng Mi Zhou Su-Pei Hu Jin Xu Lin-Dan Ji Gene Expression Profiling Identifies Downregulation of the Neurotrophin-MAPK Signaling Pathway in Female Diabetic Peripheral Neuropathy Patients Journal of Diabetes Research |
| title | Gene Expression Profiling Identifies Downregulation of the Neurotrophin-MAPK Signaling Pathway in Female Diabetic Peripheral Neuropathy Patients |
| title_full | Gene Expression Profiling Identifies Downregulation of the Neurotrophin-MAPK Signaling Pathway in Female Diabetic Peripheral Neuropathy Patients |
| title_fullStr | Gene Expression Profiling Identifies Downregulation of the Neurotrophin-MAPK Signaling Pathway in Female Diabetic Peripheral Neuropathy Patients |
| title_full_unstemmed | Gene Expression Profiling Identifies Downregulation of the Neurotrophin-MAPK Signaling Pathway in Female Diabetic Peripheral Neuropathy Patients |
| title_short | Gene Expression Profiling Identifies Downregulation of the Neurotrophin-MAPK Signaling Pathway in Female Diabetic Peripheral Neuropathy Patients |
| title_sort | gene expression profiling identifies downregulation of the neurotrophin mapk signaling pathway in female diabetic peripheral neuropathy patients |
| url | http://dx.doi.org/10.1155/2017/8103904 |
| work_keys_str_mv | AT linluo geneexpressionprofilingidentifiesdownregulationoftheneurotrophinmapksignalingpathwayinfemalediabeticperipheralneuropathypatients AT wenhuazhou geneexpressionprofilingidentifiesdownregulationoftheneurotrophinmapksignalingpathwayinfemalediabeticperipheralneuropathypatients AT jiangjiacai geneexpressionprofilingidentifiesdownregulationoftheneurotrophinmapksignalingpathwayinfemalediabeticperipheralneuropathypatients AT meifeng geneexpressionprofilingidentifiesdownregulationoftheneurotrophinmapksignalingpathwayinfemalediabeticperipheralneuropathypatients AT mizhou geneexpressionprofilingidentifiesdownregulationoftheneurotrophinmapksignalingpathwayinfemalediabeticperipheralneuropathypatients AT supeihu geneexpressionprofilingidentifiesdownregulationoftheneurotrophinmapksignalingpathwayinfemalediabeticperipheralneuropathypatients AT jinxu geneexpressionprofilingidentifiesdownregulationoftheneurotrophinmapksignalingpathwayinfemalediabeticperipheralneuropathypatients AT lindanji geneexpressionprofilingidentifiesdownregulationoftheneurotrophinmapksignalingpathwayinfemalediabeticperipheralneuropathypatients |