Prevalence and Risk Factors for Symptoms of Attention Deficit and Hyperactivity in Primary Snoring Children
Aim: Primary snoring was reported to affect 7.2% of school children in Hong Kong, and emerging evidence suggested that neurobehavioural symptoms were more frequently found among this group of children. The current study investigated the prevalence of symptoms of attention deficit hyperactivity disor...
Saved in:
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wolters Kluwer Medknow Publications
2017-07-01
|
| Series: | Pediatric Respirology and Critical Care Medicine |
| Subjects: | |
| Online Access: | https://journals.lww.com/10.4103/prcm.prcm_15_17 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850177511063814144 |
|---|---|
| author | Mei-Ching Chan Sharon Wan-Wah Cherk Ka-Li Kwok Shuk-Yu Leung Jonathan Pak-Heng Ng Rachel Shui-Ping Lee Tracy Man-Kiu Ma |
| author_facet | Mei-Ching Chan Sharon Wan-Wah Cherk Ka-Li Kwok Shuk-Yu Leung Jonathan Pak-Heng Ng Rachel Shui-Ping Lee Tracy Man-Kiu Ma |
| author_sort | Mei-Ching Chan |
| collection | DOAJ |
| description | Aim:
Primary snoring was reported to affect 7.2% of school children in Hong Kong, and emerging evidence suggested that neurobehavioural symptoms were more frequently found among this group of children. The current study investigated the prevalence of symptoms of attention deficit hyperactivity disorder (ADHD) i.e., attention deficit, hyperactivity and impulsivity (ADHI), in Chinese children with primary snoring.
Materials and Methods:
Polysomnography results and relevant clinical notes for all Chinese children aged 4–18-year performed from January 2009 to December 2010 in our sleep laboratory were retrospectively reviewed. Data of the Chinese version of modified Epworth Sleepiness Scale and C-domain of Paediatric Sleep Questionnaire were analysed.
Results:
In primary snorers, the presence of excessive daytime sleepiness (EDS) and higher apnoea–hypopnea index (AHI) were risk factors for symptoms of AD with adjusted odds ratio of 3.2 (95% confidence interval [CI] = 1.2–8.1) and 4.7 (95% CI = 1.1–20.7), respectively. Primary snorer with AD symptoms had higher AHI, 0.32 ± 0.31 compared those without symptoms, 0.21 ± 0.29, P = 0.038. EDS was an independent risk factor for ADHI with odds ratio of 4.7 (95% CI = 1.1–20.0).
Conclusion:
Early screening for symptoms of ADHD should be performed in children with primary snoring. |
| format | Article |
| id | doaj-art-7fcde5c4a9f7440eb11aa111ec31dc18 |
| institution | OA Journals |
| issn | 2543-0343 2543-0351 |
| language | English |
| publishDate | 2017-07-01 |
| publisher | Wolters Kluwer Medknow Publications |
| record_format | Article |
| series | Pediatric Respirology and Critical Care Medicine |
| spelling | doaj-art-7fcde5c4a9f7440eb11aa111ec31dc182025-08-20T02:18:58ZengWolters Kluwer Medknow PublicationsPediatric Respirology and Critical Care Medicine2543-03432543-03512017-07-0113596210.4103/prcm.prcm_15_17Prevalence and Risk Factors for Symptoms of Attention Deficit and Hyperactivity in Primary Snoring ChildrenMei-Ching ChanSharon Wan-Wah CherkKa-Li KwokShuk-Yu LeungJonathan Pak-Heng NgRachel Shui-Ping LeeTracy Man-Kiu MaAim: Primary snoring was reported to affect 7.2% of school children in Hong Kong, and emerging evidence suggested that neurobehavioural symptoms were more frequently found among this group of children. The current study investigated the prevalence of symptoms of attention deficit hyperactivity disorder (ADHD) i.e., attention deficit, hyperactivity and impulsivity (ADHI), in Chinese children with primary snoring. Materials and Methods: Polysomnography results and relevant clinical notes for all Chinese children aged 4–18-year performed from January 2009 to December 2010 in our sleep laboratory were retrospectively reviewed. Data of the Chinese version of modified Epworth Sleepiness Scale and C-domain of Paediatric Sleep Questionnaire were analysed. Results: In primary snorers, the presence of excessive daytime sleepiness (EDS) and higher apnoea–hypopnea index (AHI) were risk factors for symptoms of AD with adjusted odds ratio of 3.2 (95% confidence interval [CI] = 1.2–8.1) and 4.7 (95% CI = 1.1–20.7), respectively. Primary snorer with AD symptoms had higher AHI, 0.32 ± 0.31 compared those without symptoms, 0.21 ± 0.29, P = 0.038. EDS was an independent risk factor for ADHI with odds ratio of 4.7 (95% CI = 1.1–20.0). Conclusion: Early screening for symptoms of ADHD should be performed in children with primary snoring.https://journals.lww.com/10.4103/prcm.prcm_15_17attention deficit hyperactivity disorderexcessive somnolence disorderspolysomnographysleep-disordered breathing |
| spellingShingle | Mei-Ching Chan Sharon Wan-Wah Cherk Ka-Li Kwok Shuk-Yu Leung Jonathan Pak-Heng Ng Rachel Shui-Ping Lee Tracy Man-Kiu Ma Prevalence and Risk Factors for Symptoms of Attention Deficit and Hyperactivity in Primary Snoring Children Pediatric Respirology and Critical Care Medicine attention deficit hyperactivity disorder excessive somnolence disorders polysomnography sleep-disordered breathing |
| title | Prevalence and Risk Factors for Symptoms of Attention Deficit and Hyperactivity in Primary Snoring Children |
| title_full | Prevalence and Risk Factors for Symptoms of Attention Deficit and Hyperactivity in Primary Snoring Children |
| title_fullStr | Prevalence and Risk Factors for Symptoms of Attention Deficit and Hyperactivity in Primary Snoring Children |
| title_full_unstemmed | Prevalence and Risk Factors for Symptoms of Attention Deficit and Hyperactivity in Primary Snoring Children |
| title_short | Prevalence and Risk Factors for Symptoms of Attention Deficit and Hyperactivity in Primary Snoring Children |
| title_sort | prevalence and risk factors for symptoms of attention deficit and hyperactivity in primary snoring children |
| topic | attention deficit hyperactivity disorder excessive somnolence disorders polysomnography sleep-disordered breathing |
| url | https://journals.lww.com/10.4103/prcm.prcm_15_17 |
| work_keys_str_mv | AT meichingchan prevalenceandriskfactorsforsymptomsofattentiondeficitandhyperactivityinprimarysnoringchildren AT sharonwanwahcherk prevalenceandriskfactorsforsymptomsofattentiondeficitandhyperactivityinprimarysnoringchildren AT kalikwok prevalenceandriskfactorsforsymptomsofattentiondeficitandhyperactivityinprimarysnoringchildren AT shukyuleung prevalenceandriskfactorsforsymptomsofattentiondeficitandhyperactivityinprimarysnoringchildren AT jonathanpakhengng prevalenceandriskfactorsforsymptomsofattentiondeficitandhyperactivityinprimarysnoringchildren AT rachelshuipinglee prevalenceandriskfactorsforsymptomsofattentiondeficitandhyperactivityinprimarysnoringchildren AT tracymankiuma prevalenceandriskfactorsforsymptomsofattentiondeficitandhyperactivityinprimarysnoringchildren |