Pharmacokinetics of drugs in cachectic patients: a systematic review.
Cachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut functio...
Saved in:
| Main Authors: | , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Public Library of Science (PLoS)
2013-01-01
|
| Series: | PLoS ONE |
| Online Access: | https://doi.org/10.1371/journal.pone.0079603 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849320947952123904 |
|---|---|
| author | Katja Trobec Mojca Kerec Kos Stephan von Haehling Jochen Springer Stefan D Anker Mitja Lainscak |
| author_facet | Katja Trobec Mojca Kerec Kos Stephan von Haehling Jochen Springer Stefan D Anker Mitja Lainscak |
| author_sort | Katja Trobec |
| collection | DOAJ |
| description | Cachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut function and decreased subcutaneous tissue may influence the absorption of orally and transdermally applied drugs. Altered body composition and plasma protein concentration may affect drug distribution. Changes in the expression and function of metabolic enzymes could influence the metabolism of drugs, and their renal excretion could be affected by possible reduction in kidney function. Because no general guidelines exist for drug dose adjustments in cachectic patients, we conducted a systematic search to identify articles that investigated the pharmacokinetics of drugs in cachectic patients. |
| format | Article |
| id | doaj-art-6683ade9d54e4de489d035beaedb751e |
| institution | Kabale University |
| issn | 1932-6203 |
| language | English |
| publishDate | 2013-01-01 |
| publisher | Public Library of Science (PLoS) |
| record_format | Article |
| series | PLoS ONE |
| spelling | doaj-art-6683ade9d54e4de489d035beaedb751e2025-08-20T03:49:55ZengPublic Library of Science (PLoS)PLoS ONE1932-62032013-01-01811e7960310.1371/journal.pone.0079603Pharmacokinetics of drugs in cachectic patients: a systematic review.Katja TrobecMojca Kerec KosStephan von HaehlingJochen SpringerStefan D AnkerMitja LainscakCachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut function and decreased subcutaneous tissue may influence the absorption of orally and transdermally applied drugs. Altered body composition and plasma protein concentration may affect drug distribution. Changes in the expression and function of metabolic enzymes could influence the metabolism of drugs, and their renal excretion could be affected by possible reduction in kidney function. Because no general guidelines exist for drug dose adjustments in cachectic patients, we conducted a systematic search to identify articles that investigated the pharmacokinetics of drugs in cachectic patients.https://doi.org/10.1371/journal.pone.0079603 |
| spellingShingle | Katja Trobec Mojca Kerec Kos Stephan von Haehling Jochen Springer Stefan D Anker Mitja Lainscak Pharmacokinetics of drugs in cachectic patients: a systematic review. PLoS ONE |
| title | Pharmacokinetics of drugs in cachectic patients: a systematic review. |
| title_full | Pharmacokinetics of drugs in cachectic patients: a systematic review. |
| title_fullStr | Pharmacokinetics of drugs in cachectic patients: a systematic review. |
| title_full_unstemmed | Pharmacokinetics of drugs in cachectic patients: a systematic review. |
| title_short | Pharmacokinetics of drugs in cachectic patients: a systematic review. |
| title_sort | pharmacokinetics of drugs in cachectic patients a systematic review |
| url | https://doi.org/10.1371/journal.pone.0079603 |
| work_keys_str_mv | AT katjatrobec pharmacokineticsofdrugsincachecticpatientsasystematicreview AT mojcakereckos pharmacokineticsofdrugsincachecticpatientsasystematicreview AT stephanvonhaehling pharmacokineticsofdrugsincachecticpatientsasystematicreview AT jochenspringer pharmacokineticsofdrugsincachecticpatientsasystematicreview AT stefandanker pharmacokineticsofdrugsincachecticpatientsasystematicreview AT mitjalainscak pharmacokineticsofdrugsincachecticpatientsasystematicreview |