Pharmacokinetics of drugs in cachectic patients: a systematic review.

Cachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut functio...

Full description

Saved in:
Bibliographic Details
Main Authors: Katja Trobec, Mojca Kerec Kos, Stephan von Haehling, Jochen Springer, Stefan D Anker, Mitja Lainscak
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2013-01-01
Series:PLoS ONE
Online Access:https://doi.org/10.1371/journal.pone.0079603
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1849320947952123904
author Katja Trobec
Mojca Kerec Kos
Stephan von Haehling
Jochen Springer
Stefan D Anker
Mitja Lainscak
author_facet Katja Trobec
Mojca Kerec Kos
Stephan von Haehling
Jochen Springer
Stefan D Anker
Mitja Lainscak
author_sort Katja Trobec
collection DOAJ
description Cachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut function and decreased subcutaneous tissue may influence the absorption of orally and transdermally applied drugs. Altered body composition and plasma protein concentration may affect drug distribution. Changes in the expression and function of metabolic enzymes could influence the metabolism of drugs, and their renal excretion could be affected by possible reduction in kidney function. Because no general guidelines exist for drug dose adjustments in cachectic patients, we conducted a systematic search to identify articles that investigated the pharmacokinetics of drugs in cachectic patients.
format Article
id doaj-art-6683ade9d54e4de489d035beaedb751e
institution Kabale University
issn 1932-6203
language English
publishDate 2013-01-01
publisher Public Library of Science (PLoS)
record_format Article
series PLoS ONE
spelling doaj-art-6683ade9d54e4de489d035beaedb751e2025-08-20T03:49:55ZengPublic Library of Science (PLoS)PLoS ONE1932-62032013-01-01811e7960310.1371/journal.pone.0079603Pharmacokinetics of drugs in cachectic patients: a systematic review.Katja TrobecMojca Kerec KosStephan von HaehlingJochen SpringerStefan D AnkerMitja LainscakCachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut function and decreased subcutaneous tissue may influence the absorption of orally and transdermally applied drugs. Altered body composition and plasma protein concentration may affect drug distribution. Changes in the expression and function of metabolic enzymes could influence the metabolism of drugs, and their renal excretion could be affected by possible reduction in kidney function. Because no general guidelines exist for drug dose adjustments in cachectic patients, we conducted a systematic search to identify articles that investigated the pharmacokinetics of drugs in cachectic patients.https://doi.org/10.1371/journal.pone.0079603
spellingShingle Katja Trobec
Mojca Kerec Kos
Stephan von Haehling
Jochen Springer
Stefan D Anker
Mitja Lainscak
Pharmacokinetics of drugs in cachectic patients: a systematic review.
PLoS ONE
title Pharmacokinetics of drugs in cachectic patients: a systematic review.
title_full Pharmacokinetics of drugs in cachectic patients: a systematic review.
title_fullStr Pharmacokinetics of drugs in cachectic patients: a systematic review.
title_full_unstemmed Pharmacokinetics of drugs in cachectic patients: a systematic review.
title_short Pharmacokinetics of drugs in cachectic patients: a systematic review.
title_sort pharmacokinetics of drugs in cachectic patients a systematic review
url https://doi.org/10.1371/journal.pone.0079603
work_keys_str_mv AT katjatrobec pharmacokineticsofdrugsincachecticpatientsasystematicreview
AT mojcakereckos pharmacokineticsofdrugsincachecticpatientsasystematicreview
AT stephanvonhaehling pharmacokineticsofdrugsincachecticpatientsasystematicreview
AT jochenspringer pharmacokineticsofdrugsincachecticpatientsasystematicreview
AT stefandanker pharmacokineticsofdrugsincachecticpatientsasystematicreview
AT mitjalainscak pharmacokineticsofdrugsincachecticpatientsasystematicreview