Ybx1 deficiency impairs spermatid development and male fertility without affecting meiosis in mice: insights into spermatogenesis
Spermatogenesis is a complex process that is required for sperm production. Multiple RNA-binding proteins participate in regulating spermatogenesis. Y-box-binding protein 1 (YBX1) is involved in transcriptional regulation, mRNA stabilization, and translational repression. However, its specific role...
Saved in:
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
The Society for Reproduction and Development
2025-06-01
|
| Series: | The Journal of Reproduction and Development |
| Subjects: | |
| Online Access: | https://www.jstage.jst.go.jp/article/jrd/71/4/71_2024-108/_pdf/-char/en |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849249636247666688 |
|---|---|
| author | Yan HAN Rui WU Chaoqun DUAN Jiemin CHEN Xing DENG Wei PENG Buzhen TAN |
| author_facet | Yan HAN Rui WU Chaoqun DUAN Jiemin CHEN Xing DENG Wei PENG Buzhen TAN |
| author_sort | Yan HAN |
| collection | DOAJ |
| description | Spermatogenesis is a complex process that is required for sperm production. Multiple RNA-binding proteins participate in regulating spermatogenesis. Y-box-binding protein 1 (YBX1) is involved in transcriptional regulation, mRNA stabilization, and translational repression. However, its specific role in spermatogenesis remains unclear. This study investigated the role of YBX1 in spermatogenesis using a Ybx1 conditional knockout (Ybx1 cKO) mouse model. By analyzing the phenotype of Ybx1 cKO mice, we investigated the role of YBX1 in spermatogenesis and male fertility. The morphology and weight of Ybx1 cKO mouse testes were similar to those of wild-type (WT) testes. Sperm count and motility were lower in Ybx1 cKO mice than in WT mice. Histological analysis showed reduced numbers of elongated spermatids in seminiferous tubules and spermatozoa in tubules of the epididymis in Ybx1 cKO mice. Although YBX1 was highly expressed in the cytoplasm of spermatocytes, meiosis progressed normally in Ybx1 cKO spermatocytes. Finally, the fertilization potential of spermatozoa from Ybx1 cKO epididymis was decreased. In conclusion, our results indicate that YBX1 participates in the regulation of spermatid development but is dispensable for meiosis. |
| format | Article |
| id | doaj-art-613bcfe3fb744cc2bfd0d41cd62ed69f |
| institution | Kabale University |
| issn | 0916-8818 1348-4400 |
| language | English |
| publishDate | 2025-06-01 |
| publisher | The Society for Reproduction and Development |
| record_format | Article |
| series | The Journal of Reproduction and Development |
| spelling | doaj-art-613bcfe3fb744cc2bfd0d41cd62ed69f2025-08-20T03:57:31ZengThe Society for Reproduction and DevelopmentThe Journal of Reproduction and Development0916-88181348-44002025-06-0171421021610.1262/jrd.2024-108jrdYbx1 deficiency impairs spermatid development and male fertility without affecting meiosis in mice: insights into spermatogenesisYan HAN0Rui WU1Chaoqun DUAN2Jiemin CHEN3Xing DENG4Wei PENG5Buzhen TAN6Jiangxi Medical College, Nanchang University, Nanchang, Jiangxi Province, ChinaReproductive Medicine Center, Department of Obstetrics and Gynecology, The Affiliated Hospital of Guizhou Medical University, Guiyang, Guizhou Province, ChinaThe Assisted Reproduction Department, Yichun Maternal and Child Health Hospital, Yichun, Jiangxi Province, ChinaHubei Provincial Key Laboratory of Developmentally Originated Disease, TaiKang Medical School (School of Basic Medical Sciences), Wuhan University, Wuhan, Hubei Province, ChinaThe Assisted Reproduction Department, Yichun Maternal and Child Health Hospital, Yichun, Jiangxi Province, ChinaThe Assisted Reproduction Department, Yichun Maternal and Child Health Hospital, Yichun, Jiangxi Province, ChinaDepartment of Obstetrics and Gynecology, The Second Affiliated Hospital, Jiangxi Medical College, Nanchang University, Nanchang, Jiangxi Province, ChinaSpermatogenesis is a complex process that is required for sperm production. Multiple RNA-binding proteins participate in regulating spermatogenesis. Y-box-binding protein 1 (YBX1) is involved in transcriptional regulation, mRNA stabilization, and translational repression. However, its specific role in spermatogenesis remains unclear. This study investigated the role of YBX1 in spermatogenesis using a Ybx1 conditional knockout (Ybx1 cKO) mouse model. By analyzing the phenotype of Ybx1 cKO mice, we investigated the role of YBX1 in spermatogenesis and male fertility. The morphology and weight of Ybx1 cKO mouse testes were similar to those of wild-type (WT) testes. Sperm count and motility were lower in Ybx1 cKO mice than in WT mice. Histological analysis showed reduced numbers of elongated spermatids in seminiferous tubules and spermatozoa in tubules of the epididymis in Ybx1 cKO mice. Although YBX1 was highly expressed in the cytoplasm of spermatocytes, meiosis progressed normally in Ybx1 cKO spermatocytes. Finally, the fertilization potential of spermatozoa from Ybx1 cKO epididymis was decreased. In conclusion, our results indicate that YBX1 participates in the regulation of spermatid development but is dispensable for meiosis.https://www.jstage.jst.go.jp/article/jrd/71/4/71_2024-108/_pdf/-char/enfertilizationspermatid developmentspermatogenesissubfertilityy-box binding protein 1 |
| spellingShingle | Yan HAN Rui WU Chaoqun DUAN Jiemin CHEN Xing DENG Wei PENG Buzhen TAN Ybx1 deficiency impairs spermatid development and male fertility without affecting meiosis in mice: insights into spermatogenesis The Journal of Reproduction and Development fertilization spermatid development spermatogenesis subfertility y-box binding protein 1 |
| title | Ybx1 deficiency impairs spermatid development and male fertility without affecting meiosis in mice: insights into spermatogenesis |
| title_full | Ybx1 deficiency impairs spermatid development and male fertility without affecting meiosis in mice: insights into spermatogenesis |
| title_fullStr | Ybx1 deficiency impairs spermatid development and male fertility without affecting meiosis in mice: insights into spermatogenesis |
| title_full_unstemmed | Ybx1 deficiency impairs spermatid development and male fertility without affecting meiosis in mice: insights into spermatogenesis |
| title_short | Ybx1 deficiency impairs spermatid development and male fertility without affecting meiosis in mice: insights into spermatogenesis |
| title_sort | ybx1 deficiency impairs spermatid development and male fertility without affecting meiosis in mice insights into spermatogenesis |
| topic | fertilization spermatid development spermatogenesis subfertility y-box binding protein 1 |
| url | https://www.jstage.jst.go.jp/article/jrd/71/4/71_2024-108/_pdf/-char/en |
| work_keys_str_mv | AT yanhan ybx1deficiencyimpairsspermatiddevelopmentandmalefertilitywithoutaffectingmeiosisinmiceinsightsintospermatogenesis AT ruiwu ybx1deficiencyimpairsspermatiddevelopmentandmalefertilitywithoutaffectingmeiosisinmiceinsightsintospermatogenesis AT chaoqunduan ybx1deficiencyimpairsspermatiddevelopmentandmalefertilitywithoutaffectingmeiosisinmiceinsightsintospermatogenesis AT jieminchen ybx1deficiencyimpairsspermatiddevelopmentandmalefertilitywithoutaffectingmeiosisinmiceinsightsintospermatogenesis AT xingdeng ybx1deficiencyimpairsspermatiddevelopmentandmalefertilitywithoutaffectingmeiosisinmiceinsightsintospermatogenesis AT weipeng ybx1deficiencyimpairsspermatiddevelopmentandmalefertilitywithoutaffectingmeiosisinmiceinsightsintospermatogenesis AT buzhentan ybx1deficiencyimpairsspermatiddevelopmentandmalefertilitywithoutaffectingmeiosisinmiceinsightsintospermatogenesis |