Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis

ABSTRACT: Companion, livestock, and wild animals have various biological, behavioral, and ecological differences that may lead to distinct pathological conditions. Moreover, unlike human medicine, there is no standardized code for classifying diseases in animals, resulting in varied presentations of...

Full description

Saved in:
Bibliographic Details
Main Authors: Eduardo S.S. Sousa, Maria E.S. Sousa, Ricardo A.M. Negreiros, Moisés D.C.A. Pereira, Arthur W.L. Brasil, Inácio J. Clementino, Lilian R.C. Eloy, Sérgio S. Azevedo, Ricardo B. Lucena
Format: Article
Language:English
Published: Colégio Brasileiro de Patologia Animal (CBPA) 2024-12-01
Series:Pesquisa Veterinária Brasileira
Subjects:
Online Access:http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0100-736X2024000101200&lng=en&tlng=en
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850106324199669760
author Eduardo S.S. Sousa
Maria E.S. Sousa
Ricardo A.M. Negreiros
Moisés D.C.A. Pereira
Arthur W.L. Brasil
Inácio J. Clementino
Lilian R.C. Eloy
Sérgio S. Azevedo
Ricardo B. Lucena
author_facet Eduardo S.S. Sousa
Maria E.S. Sousa
Ricardo A.M. Negreiros
Moisés D.C.A. Pereira
Arthur W.L. Brasil
Inácio J. Clementino
Lilian R.C. Eloy
Sérgio S. Azevedo
Ricardo B. Lucena
author_sort Eduardo S.S. Sousa
collection DOAJ
description ABSTRACT: Companion, livestock, and wild animals have various biological, behavioral, and ecological differences that may lead to distinct pathological conditions. Moreover, unlike human medicine, there is no standardized code for classifying diseases in animals, resulting in varied presentations of findings across studies. Standardizing these data can help clinicians identify diseases and facilitate communication among veterinarians. A systematic review of the literature was conducted across five databases to identify the main causes of animal death in the domains “companion”, “livestock”, and “wild” animals. The analysis included the 31 articles provided in the evidence summary section. Subsequently, the causes of death were classified according to the International Classification of Diseases, tenth revision (ICD-10) and analyzed according to the presence of Garbage Codes. There was considerable diversity in the causes of death and how they were assessed and reported in each domain. Each species and domain demonstrated a high proportional mortality of causes uncommon in other domains. The companion domain included seven articles, livestock had nine articles, and wild animals had fifteen articles with 66.85%, 71.43 %, and 20.06% Garbage Codes, respectively. The different causes of death and their descriptions indicate a low level of uniformization in the presentation of findings in veterinary medicine. The causes varied based on the domains and species investigated, highlighting real distinctions between these populations. The application of ICD-10 for standardizing the diagnosis of animal mortality proved useful in detecting highly prevalent Garbage Codes.
format Article
id doaj-art-60fe0d45d0944aca998eabe9dbc4f85e
institution OA Journals
issn 1678-5150
language English
publishDate 2024-12-01
publisher Colégio Brasileiro de Patologia Animal (CBPA)
record_format Article
series Pesquisa Veterinária Brasileira
spelling doaj-art-60fe0d45d0944aca998eabe9dbc4f85e2025-08-20T02:38:51ZengColégio Brasileiro de Patologia Animal (CBPA)Pesquisa Veterinária Brasileira1678-51502024-12-014410.1590/1678-5150-pvb-7565Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysisEduardo S.S. Sousahttps://orcid.org/0000-0003-0893-5305Maria E.S. Sousahttps://orcid.org/0009-0006-7648-1885Ricardo A.M. Negreiroshttps://orcid.org/0000-0003-1764-0939Moisés D.C.A. Pereirahttps://orcid.org/0000-0002-7894-6758Arthur W.L. Brasilhttps://orcid.org/0000-0002-1862-6517Inácio J. Clementinohttps://orcid.org/0000-0001-5788-2583Lilian R.C. Eloyhttps://orcid.org/0009-0000-0778-6315Sérgio S. Azevedohttps://orcid.org/0000-0002-1777-7348Ricardo B. Lucenahttps://orcid.org/0000-0002-2968-5766ABSTRACT: Companion, livestock, and wild animals have various biological, behavioral, and ecological differences that may lead to distinct pathological conditions. Moreover, unlike human medicine, there is no standardized code for classifying diseases in animals, resulting in varied presentations of findings across studies. Standardizing these data can help clinicians identify diseases and facilitate communication among veterinarians. A systematic review of the literature was conducted across five databases to identify the main causes of animal death in the domains “companion”, “livestock”, and “wild” animals. The analysis included the 31 articles provided in the evidence summary section. Subsequently, the causes of death were classified according to the International Classification of Diseases, tenth revision (ICD-10) and analyzed according to the presence of Garbage Codes. There was considerable diversity in the causes of death and how they were assessed and reported in each domain. Each species and domain demonstrated a high proportional mortality of causes uncommon in other domains. The companion domain included seven articles, livestock had nine articles, and wild animals had fifteen articles with 66.85%, 71.43 %, and 20.06% Garbage Codes, respectively. The different causes of death and their descriptions indicate a low level of uniformization in the presentation of findings in veterinary medicine. The causes varied based on the domains and species investigated, highlighting real distinctions between these populations. The application of ICD-10 for standardizing the diagnosis of animal mortality proved useful in detecting highly prevalent Garbage Codes.http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0100-736X2024000101200&lng=en&tlng=enAnimal welfarecauses of mortalityGarbage CodeICD-10One Health
spellingShingle Eduardo S.S. Sousa
Maria E.S. Sousa
Ricardo A.M. Negreiros
Moisés D.C.A. Pereira
Arthur W.L. Brasil
Inácio J. Clementino
Lilian R.C. Eloy
Sérgio S. Azevedo
Ricardo B. Lucena
Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis
Pesquisa Veterinária Brasileira
Animal welfare
causes of mortality
Garbage Code
ICD-10
One Health
title Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis
title_full Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis
title_fullStr Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis
title_full_unstemmed Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis
title_short Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis
title_sort causes of death in companion livestock and wild animals a systematic review and garbage codes analysis
topic Animal welfare
causes of mortality
Garbage Code
ICD-10
One Health
url http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0100-736X2024000101200&lng=en&tlng=en
work_keys_str_mv AT eduardosssousa causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis
AT mariaessousa causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis
AT ricardoamnegreiros causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis
AT moisesdcapereira causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis
AT arthurwlbrasil causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis
AT inaciojclementino causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis
AT lilianrceloy causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis
AT sergiosazevedo causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis
AT ricardoblucena causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis