Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis
ABSTRACT: Companion, livestock, and wild animals have various biological, behavioral, and ecological differences that may lead to distinct pathological conditions. Moreover, unlike human medicine, there is no standardized code for classifying diseases in animals, resulting in varied presentations of...
Saved in:
| Main Authors: | , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Colégio Brasileiro de Patologia Animal (CBPA)
2024-12-01
|
| Series: | Pesquisa Veterinária Brasileira |
| Subjects: | |
| Online Access: | http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0100-736X2024000101200&lng=en&tlng=en |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850106324199669760 |
|---|---|
| author | Eduardo S.S. Sousa Maria E.S. Sousa Ricardo A.M. Negreiros Moisés D.C.A. Pereira Arthur W.L. Brasil Inácio J. Clementino Lilian R.C. Eloy Sérgio S. Azevedo Ricardo B. Lucena |
| author_facet | Eduardo S.S. Sousa Maria E.S. Sousa Ricardo A.M. Negreiros Moisés D.C.A. Pereira Arthur W.L. Brasil Inácio J. Clementino Lilian R.C. Eloy Sérgio S. Azevedo Ricardo B. Lucena |
| author_sort | Eduardo S.S. Sousa |
| collection | DOAJ |
| description | ABSTRACT: Companion, livestock, and wild animals have various biological, behavioral, and ecological differences that may lead to distinct pathological conditions. Moreover, unlike human medicine, there is no standardized code for classifying diseases in animals, resulting in varied presentations of findings across studies. Standardizing these data can help clinicians identify diseases and facilitate communication among veterinarians. A systematic review of the literature was conducted across five databases to identify the main causes of animal death in the domains “companion”, “livestock”, and “wild” animals. The analysis included the 31 articles provided in the evidence summary section. Subsequently, the causes of death were classified according to the International Classification of Diseases, tenth revision (ICD-10) and analyzed according to the presence of Garbage Codes. There was considerable diversity in the causes of death and how they were assessed and reported in each domain. Each species and domain demonstrated a high proportional mortality of causes uncommon in other domains. The companion domain included seven articles, livestock had nine articles, and wild animals had fifteen articles with 66.85%, 71.43 %, and 20.06% Garbage Codes, respectively. The different causes of death and their descriptions indicate a low level of uniformization in the presentation of findings in veterinary medicine. The causes varied based on the domains and species investigated, highlighting real distinctions between these populations. The application of ICD-10 for standardizing the diagnosis of animal mortality proved useful in detecting highly prevalent Garbage Codes. |
| format | Article |
| id | doaj-art-60fe0d45d0944aca998eabe9dbc4f85e |
| institution | OA Journals |
| issn | 1678-5150 |
| language | English |
| publishDate | 2024-12-01 |
| publisher | Colégio Brasileiro de Patologia Animal (CBPA) |
| record_format | Article |
| series | Pesquisa Veterinária Brasileira |
| spelling | doaj-art-60fe0d45d0944aca998eabe9dbc4f85e2025-08-20T02:38:51ZengColégio Brasileiro de Patologia Animal (CBPA)Pesquisa Veterinária Brasileira1678-51502024-12-014410.1590/1678-5150-pvb-7565Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysisEduardo S.S. Sousahttps://orcid.org/0000-0003-0893-5305Maria E.S. Sousahttps://orcid.org/0009-0006-7648-1885Ricardo A.M. Negreiroshttps://orcid.org/0000-0003-1764-0939Moisés D.C.A. Pereirahttps://orcid.org/0000-0002-7894-6758Arthur W.L. Brasilhttps://orcid.org/0000-0002-1862-6517Inácio J. Clementinohttps://orcid.org/0000-0001-5788-2583Lilian R.C. Eloyhttps://orcid.org/0009-0000-0778-6315Sérgio S. Azevedohttps://orcid.org/0000-0002-1777-7348Ricardo B. Lucenahttps://orcid.org/0000-0002-2968-5766ABSTRACT: Companion, livestock, and wild animals have various biological, behavioral, and ecological differences that may lead to distinct pathological conditions. Moreover, unlike human medicine, there is no standardized code for classifying diseases in animals, resulting in varied presentations of findings across studies. Standardizing these data can help clinicians identify diseases and facilitate communication among veterinarians. A systematic review of the literature was conducted across five databases to identify the main causes of animal death in the domains “companion”, “livestock”, and “wild” animals. The analysis included the 31 articles provided in the evidence summary section. Subsequently, the causes of death were classified according to the International Classification of Diseases, tenth revision (ICD-10) and analyzed according to the presence of Garbage Codes. There was considerable diversity in the causes of death and how they were assessed and reported in each domain. Each species and domain demonstrated a high proportional mortality of causes uncommon in other domains. The companion domain included seven articles, livestock had nine articles, and wild animals had fifteen articles with 66.85%, 71.43 %, and 20.06% Garbage Codes, respectively. The different causes of death and their descriptions indicate a low level of uniformization in the presentation of findings in veterinary medicine. The causes varied based on the domains and species investigated, highlighting real distinctions between these populations. The application of ICD-10 for standardizing the diagnosis of animal mortality proved useful in detecting highly prevalent Garbage Codes.http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0100-736X2024000101200&lng=en&tlng=enAnimal welfarecauses of mortalityGarbage CodeICD-10One Health |
| spellingShingle | Eduardo S.S. Sousa Maria E.S. Sousa Ricardo A.M. Negreiros Moisés D.C.A. Pereira Arthur W.L. Brasil Inácio J. Clementino Lilian R.C. Eloy Sérgio S. Azevedo Ricardo B. Lucena Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis Pesquisa Veterinária Brasileira Animal welfare causes of mortality Garbage Code ICD-10 One Health |
| title | Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis |
| title_full | Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis |
| title_fullStr | Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis |
| title_full_unstemmed | Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis |
| title_short | Causes of death in companion, livestock, and wild animals: A systematic review and Garbage Codes analysis |
| title_sort | causes of death in companion livestock and wild animals a systematic review and garbage codes analysis |
| topic | Animal welfare causes of mortality Garbage Code ICD-10 One Health |
| url | http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0100-736X2024000101200&lng=en&tlng=en |
| work_keys_str_mv | AT eduardosssousa causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis AT mariaessousa causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis AT ricardoamnegreiros causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis AT moisesdcapereira causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis AT arthurwlbrasil causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis AT inaciojclementino causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis AT lilianrceloy causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis AT sergiosazevedo causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis AT ricardoblucena causesofdeathincompanionlivestockandwildanimalsasystematicreviewandgarbagecodesanalysis |