Selective autophagy impedes KSHV entry after recruiting the membrane damage sensor galectin-8 to virus-containing endosomes

Summary: Kaposi sarcoma-associated herpesvirus (KSHV) is an oncogenic γ-herpesvirus. Autophagy during KSHV entry has remained unexplored. We show that LC3 lipidation as a hallmark of autophagy is induced shortly after KSHV entry. LC3 co-localizes with KSHV in amphisomes during entry and loss of LC3...

Full description

Saved in:
Bibliographic Details
Main Authors: Katarina Wendy Schmidt, Charlotte Montespan, Danielle Thompson, Miriam S. Lucas, Laure-Anne Ligeon, Harald Wodrich, Alexander S. Hahn, Urs F. Greber, Christian Münz
Format: Article
Language:English
Published: Elsevier 2024-12-01
Series:Cell Reports
Subjects:
Online Access:http://www.sciencedirect.com/science/article/pii/S2211124724013706
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850066689695154176
author Katarina Wendy Schmidt
Charlotte Montespan
Danielle Thompson
Miriam S. Lucas
Laure-Anne Ligeon
Harald Wodrich
Alexander S. Hahn
Urs F. Greber
Christian Münz
author_facet Katarina Wendy Schmidt
Charlotte Montespan
Danielle Thompson
Miriam S. Lucas
Laure-Anne Ligeon
Harald Wodrich
Alexander S. Hahn
Urs F. Greber
Christian Münz
author_sort Katarina Wendy Schmidt
collection DOAJ
description Summary: Kaposi sarcoma-associated herpesvirus (KSHV) is an oncogenic γ-herpesvirus. Autophagy during KSHV entry has remained unexplored. We show that LC3 lipidation as a hallmark of autophagy is induced shortly after KSHV entry. LC3 co-localizes with KSHV in amphisomes during entry and loss of LC3 lipidation increases infection. Accordingly, NDP52, a receptor of selective autophagy, was recruited to endocytosed viral particles, and its reduction increased KSHV infection. Additionally, virus particles co-localized with the endolysosome damage sensor galectin-8 upon KSHV entry and depletion of galectin-8 promoted KSHV infection. Compared with herpes simplex virus, listeriolysin, adenovirus, and influenza virus, and in contrast to what was previously thought about enveloped viruses, KSHV binding to EphA2 by its envelope protein gH causes endolysosomal membrane damage, akin to non-enveloped viruses and bacteria. Taken together, our study identifies an important anti-viral role for galectin-8, NDP52, and the autophagy machinery at virus-damaged endosomes, restricting KSHV entry by selective autophagy.
format Article
id doaj-art-5e3e4b63b6604084a7707d800fee0cfc
institution DOAJ
issn 2211-1247
language English
publishDate 2024-12-01
publisher Elsevier
record_format Article
series Cell Reports
spelling doaj-art-5e3e4b63b6604084a7707d800fee0cfc2025-08-20T02:48:39ZengElsevierCell Reports2211-12472024-12-01431211501910.1016/j.celrep.2024.115019Selective autophagy impedes KSHV entry after recruiting the membrane damage sensor galectin-8 to virus-containing endosomesKatarina Wendy Schmidt0Charlotte Montespan1Danielle Thompson2Miriam S. Lucas3Laure-Anne Ligeon4Harald Wodrich5Alexander S. Hahn6Urs F. Greber7Christian Münz8Viral Immunobiology, Institute of Experimental Immunology, University of Zurich, 8057 Zurich, SwitzerlandViral Immunobiology, Institute of Experimental Immunology, University of Zurich, 8057 Zurich, SwitzerlandViral Immunobiology, Institute of Experimental Immunology, University of Zurich, 8057 Zurich, SwitzerlandScopeM – Scientific Center for Optical and Electron Microscopy, ETH Zurich, 8093 Zurich, SwitzerlandViral Immunobiology, Institute of Experimental Immunology, University of Zurich, 8057 Zurich, SwitzerlandCNRS UMR 5234, Fundamental Microbiology and Pathogenicity, University of Bordeaux, 33063 Bordeaux, FranceGerman Primate Center, University of Göttingen, 37077 Göttingen, GermanyInstitute of Molecular Life Sciences, University of Zurich, 8057 Zurich, SwitzerlandViral Immunobiology, Institute of Experimental Immunology, University of Zurich, 8057 Zurich, Switzerland; Corresponding authorSummary: Kaposi sarcoma-associated herpesvirus (KSHV) is an oncogenic γ-herpesvirus. Autophagy during KSHV entry has remained unexplored. We show that LC3 lipidation as a hallmark of autophagy is induced shortly after KSHV entry. LC3 co-localizes with KSHV in amphisomes during entry and loss of LC3 lipidation increases infection. Accordingly, NDP52, a receptor of selective autophagy, was recruited to endocytosed viral particles, and its reduction increased KSHV infection. Additionally, virus particles co-localized with the endolysosome damage sensor galectin-8 upon KSHV entry and depletion of galectin-8 promoted KSHV infection. Compared with herpes simplex virus, listeriolysin, adenovirus, and influenza virus, and in contrast to what was previously thought about enveloped viruses, KSHV binding to EphA2 by its envelope protein gH causes endolysosomal membrane damage, akin to non-enveloped viruses and bacteria. Taken together, our study identifies an important anti-viral role for galectin-8, NDP52, and the autophagy machinery at virus-damaged endosomes, restricting KSHV entry by selective autophagy.http://www.sciencedirect.com/science/article/pii/S2211124724013706CP: ImmunologyCP: Microbiology
spellingShingle Katarina Wendy Schmidt
Charlotte Montespan
Danielle Thompson
Miriam S. Lucas
Laure-Anne Ligeon
Harald Wodrich
Alexander S. Hahn
Urs F. Greber
Christian Münz
Selective autophagy impedes KSHV entry after recruiting the membrane damage sensor galectin-8 to virus-containing endosomes
Cell Reports
CP: Immunology
CP: Microbiology
title Selective autophagy impedes KSHV entry after recruiting the membrane damage sensor galectin-8 to virus-containing endosomes
title_full Selective autophagy impedes KSHV entry after recruiting the membrane damage sensor galectin-8 to virus-containing endosomes
title_fullStr Selective autophagy impedes KSHV entry after recruiting the membrane damage sensor galectin-8 to virus-containing endosomes
title_full_unstemmed Selective autophagy impedes KSHV entry after recruiting the membrane damage sensor galectin-8 to virus-containing endosomes
title_short Selective autophagy impedes KSHV entry after recruiting the membrane damage sensor galectin-8 to virus-containing endosomes
title_sort selective autophagy impedes kshv entry after recruiting the membrane damage sensor galectin 8 to virus containing endosomes
topic CP: Immunology
CP: Microbiology
url http://www.sciencedirect.com/science/article/pii/S2211124724013706
work_keys_str_mv AT katarinawendyschmidt selectiveautophagyimpedeskshventryafterrecruitingthemembranedamagesensorgalectin8toviruscontainingendosomes
AT charlottemontespan selectiveautophagyimpedeskshventryafterrecruitingthemembranedamagesensorgalectin8toviruscontainingendosomes
AT daniellethompson selectiveautophagyimpedeskshventryafterrecruitingthemembranedamagesensorgalectin8toviruscontainingendosomes
AT miriamslucas selectiveautophagyimpedeskshventryafterrecruitingthemembranedamagesensorgalectin8toviruscontainingendosomes
AT laureanneligeon selectiveautophagyimpedeskshventryafterrecruitingthemembranedamagesensorgalectin8toviruscontainingendosomes
AT haraldwodrich selectiveautophagyimpedeskshventryafterrecruitingthemembranedamagesensorgalectin8toviruscontainingendosomes
AT alexandershahn selectiveautophagyimpedeskshventryafterrecruitingthemembranedamagesensorgalectin8toviruscontainingendosomes
AT ursfgreber selectiveautophagyimpedeskshventryafterrecruitingthemembranedamagesensorgalectin8toviruscontainingendosomes
AT christianmunz selectiveautophagyimpedeskshventryafterrecruitingthemembranedamagesensorgalectin8toviruscontainingendosomes