Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.)
Serine carboxypeptidase-like (SCPL) proteins are a group of acyltransferase enzymes that have important roles in plant growth, development, and stress responses. Although SCPL proteins have been studied in many plants, the biological functions of SCPL genes in grape are still unknown. In this study,...
Saved in:
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
KeAi Communications Co., Ltd.
2021-10-01
|
| Series: | Journal of Integrative Agriculture |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S2095311920635870 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849253864873656320 |
|---|---|
| author | Xi-cheng WANG Wei-min WU Bei-bei ZHOU Zhuang-wei WANG Ya-ming QIAN Bo WANG Li-chun YAN |
| author_facet | Xi-cheng WANG Wei-min WU Bei-bei ZHOU Zhuang-wei WANG Ya-ming QIAN Bo WANG Li-chun YAN |
| author_sort | Xi-cheng WANG |
| collection | DOAJ |
| description | Serine carboxypeptidase-like (SCPL) proteins are a group of acyltransferase enzymes that have important roles in plant growth, development, and stress responses. Although SCPL proteins have been studied in many plants, the biological functions of SCPL genes in grape are still unknown. In this study, 59 putative SCPL proteins were identified from the grape genome. A bioinformatics analysis, including chromosomal locations, exon/intron structures, phylogeny, cis-elements, and conserved motifs, was performed for the gene family. The phylogenetic analysis revealed that VvSCPL proteins could be classified into three groups, with the gene motifs in each group showing high similarity levels. The number of exons in the VvSCPL genes ranged from 1 to 19, suggesting significant variations among grape SCPL genes. The expression of the VvSCPL genes, as assessed by RNA sequencing (RNA-seq) and quantitative real-time PCR, showed that most VvSCPL genes responded to drought- and waterlogging-stress treatments, which indicated their roles in abiotic stress responses. The results provide useful information for further study of SCPL genes in grape. |
| format | Article |
| id | doaj-art-59f5ecbf0d774bac948bdb9c1bd379e2 |
| institution | Kabale University |
| issn | 2095-3119 |
| language | English |
| publishDate | 2021-10-01 |
| publisher | KeAi Communications Co., Ltd. |
| record_format | Article |
| series | Journal of Integrative Agriculture |
| spelling | doaj-art-59f5ecbf0d774bac948bdb9c1bd379e22025-08-20T03:56:12ZengKeAi Communications Co., Ltd.Journal of Integrative Agriculture2095-31192021-10-0120102666267910.1016/S2095-3119(20)63587-0Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.)Xi-cheng WANG0Wei-min WU1Bei-bei ZHOU2Zhuang-wei WANG3Ya-ming QIAN4Bo WANG5Li-chun YAN6Institute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaCorrespondence WU Wei-min, Tel/Fax: +86-25-84392902; Institute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaInstitute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaInstitute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaInstitute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaInstitute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaInstitute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaSerine carboxypeptidase-like (SCPL) proteins are a group of acyltransferase enzymes that have important roles in plant growth, development, and stress responses. Although SCPL proteins have been studied in many plants, the biological functions of SCPL genes in grape are still unknown. In this study, 59 putative SCPL proteins were identified from the grape genome. A bioinformatics analysis, including chromosomal locations, exon/intron structures, phylogeny, cis-elements, and conserved motifs, was performed for the gene family. The phylogenetic analysis revealed that VvSCPL proteins could be classified into three groups, with the gene motifs in each group showing high similarity levels. The number of exons in the VvSCPL genes ranged from 1 to 19, suggesting significant variations among grape SCPL genes. The expression of the VvSCPL genes, as assessed by RNA sequencing (RNA-seq) and quantitative real-time PCR, showed that most VvSCPL genes responded to drought- and waterlogging-stress treatments, which indicated their roles in abiotic stress responses. The results provide useful information for further study of SCPL genes in grape.http://www.sciencedirect.com/science/article/pii/S2095311920635870serine carboxypeptidase-like (SCPL) proteingrapephylogenetic relationshipsabiotic stressgene expression |
| spellingShingle | Xi-cheng WANG Wei-min WU Bei-bei ZHOU Zhuang-wei WANG Ya-ming QIAN Bo WANG Li-chun YAN Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.) Journal of Integrative Agriculture serine carboxypeptidase-like (SCPL) protein grape phylogenetic relationships abiotic stress gene expression |
| title | Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.) |
| title_full | Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.) |
| title_fullStr | Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.) |
| title_full_unstemmed | Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.) |
| title_short | Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.) |
| title_sort | genome wide analysis of the scpl gene family in grape vitis vinifera l |
| topic | serine carboxypeptidase-like (SCPL) protein grape phylogenetic relationships abiotic stress gene expression |
| url | http://www.sciencedirect.com/science/article/pii/S2095311920635870 |
| work_keys_str_mv | AT xichengwang genomewideanalysisofthescplgenefamilyingrapevitisviniferal AT weiminwu genomewideanalysisofthescplgenefamilyingrapevitisviniferal AT beibeizhou genomewideanalysisofthescplgenefamilyingrapevitisviniferal AT zhuangweiwang genomewideanalysisofthescplgenefamilyingrapevitisviniferal AT yamingqian genomewideanalysisofthescplgenefamilyingrapevitisviniferal AT bowang genomewideanalysisofthescplgenefamilyingrapevitisviniferal AT lichunyan genomewideanalysisofthescplgenefamilyingrapevitisviniferal |