Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.)

Serine carboxypeptidase-like (SCPL) proteins are a group of acyltransferase enzymes that have important roles in plant growth, development, and stress responses. Although SCPL proteins have been studied in many plants, the biological functions of SCPL genes in grape are still unknown. In this study,...

Full description

Saved in:
Bibliographic Details
Main Authors: Xi-cheng WANG, Wei-min WU, Bei-bei ZHOU, Zhuang-wei WANG, Ya-ming QIAN, Bo WANG, Li-chun YAN
Format: Article
Language:English
Published: KeAi Communications Co., Ltd. 2021-10-01
Series:Journal of Integrative Agriculture
Subjects:
Online Access:http://www.sciencedirect.com/science/article/pii/S2095311920635870
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1849253864873656320
author Xi-cheng WANG
Wei-min WU
Bei-bei ZHOU
Zhuang-wei WANG
Ya-ming QIAN
Bo WANG
Li-chun YAN
author_facet Xi-cheng WANG
Wei-min WU
Bei-bei ZHOU
Zhuang-wei WANG
Ya-ming QIAN
Bo WANG
Li-chun YAN
author_sort Xi-cheng WANG
collection DOAJ
description Serine carboxypeptidase-like (SCPL) proteins are a group of acyltransferase enzymes that have important roles in plant growth, development, and stress responses. Although SCPL proteins have been studied in many plants, the biological functions of SCPL genes in grape are still unknown. In this study, 59 putative SCPL proteins were identified from the grape genome. A bioinformatics analysis, including chromosomal locations, exon/intron structures, phylogeny, cis-elements, and conserved motifs, was performed for the gene family. The phylogenetic analysis revealed that VvSCPL proteins could be classified into three groups, with the gene motifs in each group showing high similarity levels. The number of exons in the VvSCPL genes ranged from 1 to 19, suggesting significant variations among grape SCPL genes. The expression of the VvSCPL genes, as assessed by RNA sequencing (RNA-seq) and quantitative real-time PCR, showed that most VvSCPL genes responded to drought- and waterlogging-stress treatments, which indicated their roles in abiotic stress responses. The results provide useful information for further study of SCPL genes in grape.
format Article
id doaj-art-59f5ecbf0d774bac948bdb9c1bd379e2
institution Kabale University
issn 2095-3119
language English
publishDate 2021-10-01
publisher KeAi Communications Co., Ltd.
record_format Article
series Journal of Integrative Agriculture
spelling doaj-art-59f5ecbf0d774bac948bdb9c1bd379e22025-08-20T03:56:12ZengKeAi Communications Co., Ltd.Journal of Integrative Agriculture2095-31192021-10-0120102666267910.1016/S2095-3119(20)63587-0Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.)Xi-cheng WANG0Wei-min WU1Bei-bei ZHOU2Zhuang-wei WANG3Ya-ming QIAN4Bo WANG5Li-chun YAN6Institute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaCorrespondence WU Wei-min, Tel/Fax: +86-25-84392902; Institute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaInstitute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaInstitute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaInstitute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaInstitute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaInstitute of Pomology, Jiangsu Academy of Agricultural Sciences/Jiangsu Key Laboratory for Horticultural Crop Genetic Improvement, Nanjing 210014, P.R.ChinaSerine carboxypeptidase-like (SCPL) proteins are a group of acyltransferase enzymes that have important roles in plant growth, development, and stress responses. Although SCPL proteins have been studied in many plants, the biological functions of SCPL genes in grape are still unknown. In this study, 59 putative SCPL proteins were identified from the grape genome. A bioinformatics analysis, including chromosomal locations, exon/intron structures, phylogeny, cis-elements, and conserved motifs, was performed for the gene family. The phylogenetic analysis revealed that VvSCPL proteins could be classified into three groups, with the gene motifs in each group showing high similarity levels. The number of exons in the VvSCPL genes ranged from 1 to 19, suggesting significant variations among grape SCPL genes. The expression of the VvSCPL genes, as assessed by RNA sequencing (RNA-seq) and quantitative real-time PCR, showed that most VvSCPL genes responded to drought- and waterlogging-stress treatments, which indicated their roles in abiotic stress responses. The results provide useful information for further study of SCPL genes in grape.http://www.sciencedirect.com/science/article/pii/S2095311920635870serine carboxypeptidase-like (SCPL) proteingrapephylogenetic relationshipsabiotic stressgene expression
spellingShingle Xi-cheng WANG
Wei-min WU
Bei-bei ZHOU
Zhuang-wei WANG
Ya-ming QIAN
Bo WANG
Li-chun YAN
Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.)
Journal of Integrative Agriculture
serine carboxypeptidase-like (SCPL) protein
grape
phylogenetic relationships
abiotic stress
gene expression
title Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.)
title_full Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.)
title_fullStr Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.)
title_full_unstemmed Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.)
title_short Genome-wide analysis of the SCPL gene family in grape (Vitis vinifera L.)
title_sort genome wide analysis of the scpl gene family in grape vitis vinifera l
topic serine carboxypeptidase-like (SCPL) protein
grape
phylogenetic relationships
abiotic stress
gene expression
url http://www.sciencedirect.com/science/article/pii/S2095311920635870
work_keys_str_mv AT xichengwang genomewideanalysisofthescplgenefamilyingrapevitisviniferal
AT weiminwu genomewideanalysisofthescplgenefamilyingrapevitisviniferal
AT beibeizhou genomewideanalysisofthescplgenefamilyingrapevitisviniferal
AT zhuangweiwang genomewideanalysisofthescplgenefamilyingrapevitisviniferal
AT yamingqian genomewideanalysisofthescplgenefamilyingrapevitisviniferal
AT bowang genomewideanalysisofthescplgenefamilyingrapevitisviniferal
AT lichunyan genomewideanalysisofthescplgenefamilyingrapevitisviniferal