Value of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus

Value of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus Aim. The aim of the current study was to investigate urinary adiponectin, VCAM-1, and RBP 4 levels in children depending on the diabetes duration. Materials and methods....

Full description

Saved in:
Bibliographic Details
Main Authors: I. O. Vikhrova, A. M. Loboda
Format: Article
Language:English
Published: Zaporizhzhia State Medical and Pharmaceutical University 2021-02-01
Series:Zaporožskij Medicinskij Žurnal
Subjects:
Online Access:http://zmj.zsmu.edu.ua/article/view/224886/225173
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1849435251165626368
author I. O. Vikhrova
A. M. Loboda
author_facet I. O. Vikhrova
A. M. Loboda
author_sort I. O. Vikhrova
collection DOAJ
description Value of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus Aim. The aim of the current study was to investigate urinary adiponectin, VCAM-1, and RBP 4 levels in children depending on the diabetes duration. Materials and methods. The study involved 55 subjects, including 47 children with type 1 diabetes mellitus and eight children without diabetes and kidney disease history. Participants with diabetes were stratified into three groups, depending on the diabetes duration: <1 year (11 people), 1–5 years (24 people) and >5 years (12 people). According to the Order of the Ministry of Health of Ukraine, dated April 27, 2006, No. 254 on providing medical care to children in the specialty “Pediatric Endocrinology”, we examined the children and diagnosed type 1 diabetes mellitus. Chemiluminescence signals of adiponectin, VCAM-1, and RBP4 in urine were analyzed with Bio-Rad ChemiDoc Touch using a Proteome Profiler Human Kidney Biomarker Antibody Array (R&D Systems, Minneapolis, USA). We used descriptive statistics and nonparametric methods (contingency tables and Spearman’s rank correlation coefficient (r)) for the statistical analysis of study materials. Statistically significant differences were indicated by P values <0.05. Results. Urinary adiponectin, VCAM-1, and RBP 4 levels statistically increased within the first year after diagnosing type 1 diabetes in children. Adiponectin was strongly correlated with VCAM-1 (r = 0.636, P = 0.026), and RBP 4 (r = 0.650, P = 0.022). Urinary adiponectin levels showed a statistically significant correlation with GFR (r = 0.007). Conclusions. Serum creatinine and GFR are ineffective as diagnostic indicators of kidney damage in children with diabetes mellitus at the incipient stages. Adiponectin in children’s urine can be used as a non-invasive kidney damage marker in the early years of type 1 diabetes. Adiponectin, VCAM-1, and RBP 4 measurements would allow an early prediction and evaluation of both tubular and glomerular kidney damage in children with diabetes.
format Article
id doaj-art-4f2b7ecb41f746a8a0d84ea361c4ed47
institution Kabale University
issn 2306-4145
2310-1210
language English
publishDate 2021-02-01
publisher Zaporizhzhia State Medical and Pharmaceutical University
record_format Article
series Zaporožskij Medicinskij Žurnal
spelling doaj-art-4f2b7ecb41f746a8a0d84ea361c4ed472025-08-20T03:26:21ZengZaporizhzhia State Medical and Pharmaceutical UniversityZaporožskij Medicinskij Žurnal2306-41452310-12102021-02-01231727610.14739/2310-1210.2021.1.224886Value of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitusI. O. Vikhrova0https://orcid.org/0000-0002-5314-9955A. M. Loboda1https://orcid.org/0000-0002-5400-773XSumy State University, UkraineSumy State University, UkraineValue of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus Aim. The aim of the current study was to investigate urinary adiponectin, VCAM-1, and RBP 4 levels in children depending on the diabetes duration. Materials and methods. The study involved 55 subjects, including 47 children with type 1 diabetes mellitus and eight children without diabetes and kidney disease history. Participants with diabetes were stratified into three groups, depending on the diabetes duration: <1 year (11 people), 1–5 years (24 people) and >5 years (12 people). According to the Order of the Ministry of Health of Ukraine, dated April 27, 2006, No. 254 on providing medical care to children in the specialty “Pediatric Endocrinology”, we examined the children and diagnosed type 1 diabetes mellitus. Chemiluminescence signals of adiponectin, VCAM-1, and RBP4 in urine were analyzed with Bio-Rad ChemiDoc Touch using a Proteome Profiler Human Kidney Biomarker Antibody Array (R&D Systems, Minneapolis, USA). We used descriptive statistics and nonparametric methods (contingency tables and Spearman’s rank correlation coefficient (r)) for the statistical analysis of study materials. Statistically significant differences were indicated by P values <0.05. Results. Urinary adiponectin, VCAM-1, and RBP 4 levels statistically increased within the first year after diagnosing type 1 diabetes in children. Adiponectin was strongly correlated with VCAM-1 (r = 0.636, P = 0.026), and RBP 4 (r = 0.650, P = 0.022). Urinary adiponectin levels showed a statistically significant correlation with GFR (r = 0.007). Conclusions. Serum creatinine and GFR are ineffective as diagnostic indicators of kidney damage in children with diabetes mellitus at the incipient stages. Adiponectin in children’s urine can be used as a non-invasive kidney damage marker in the early years of type 1 diabetes. Adiponectin, VCAM-1, and RBP 4 measurements would allow an early prediction and evaluation of both tubular and glomerular kidney damage in children with diabetes.http://zmj.zsmu.edu.ua/article/view/224886/225173diabetes mellitusdiabetic nephropathychildrenbiomarkersadiponectinvcam-1rbp 4
spellingShingle I. O. Vikhrova
A. M. Loboda
Value of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus
Zaporožskij Medicinskij Žurnal
diabetes mellitus
diabetic nephropathy
children
biomarkers
adiponectin
vcam-1
rbp 4
title Value of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus
title_full Value of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus
title_fullStr Value of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus
title_full_unstemmed Value of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus
title_short Value of urinary adiponectin, VCAM-1 and RBP 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus
title_sort value of urinary adiponectin vcam 1 and rbp 4 in early diagnosis of kidney damage in children with type 1 diabetes mellitus
topic diabetes mellitus
diabetic nephropathy
children
biomarkers
adiponectin
vcam-1
rbp 4
url http://zmj.zsmu.edu.ua/article/view/224886/225173
work_keys_str_mv AT iovikhrova valueofurinaryadiponectinvcam1andrbp4inearlydiagnosisofkidneydamageinchildrenwithtype1diabetesmellitus
AT amloboda valueofurinaryadiponectinvcam1andrbp4inearlydiagnosisofkidneydamageinchildrenwithtype1diabetesmellitus