Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter]

Yanni Gao,1 Zhenliang Fan2 1The First School of Clinical Medicine, Zhejiang Chinese Medical University, Hangzhou, Zhejiang, 310053, People’s Republic of China; 2The First Affiliated Hospital of Zhejiang Chinese Medical University (Zhejiang Provincial Hospital of Chinese Medicine), Hang...

Full description

Saved in:
Bibliographic Details
Main Authors: Gao Y, Fan Z
Format: Article
Language:English
Published: Dove Medical Press 2025-05-01
Series:Diabetes, Metabolic Syndrome and Obesity
Subjects:
Online Access:https://www.dovepress.com/redefining-thyroid-hormone-sensitivity-in-diabetic-kidney-disease-a-pa-peer-reviewed-fulltext-article-DMSO
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850157286369001472
author Gao Y
Fan Z
author_facet Gao Y
Fan Z
author_sort Gao Y
collection DOAJ
description Yanni Gao,1 Zhenliang Fan2 1The First School of Clinical Medicine, Zhejiang Chinese Medical University, Hangzhou, Zhejiang, 310053, People’s Republic of China; 2The First Affiliated Hospital of Zhejiang Chinese Medical University (Zhejiang Provincial Hospital of Chinese Medicine), Hangzhou, Zhejiang, 310006, People’s Republic of ChinaCorrespondence: Zhenliang Fan, Email fanmlov@sina.cn
format Article
id doaj-art-47dc8026913e47c2bd16add4bdd786ef
institution OA Journals
issn 1178-7007
language English
publishDate 2025-05-01
publisher Dove Medical Press
record_format Article
series Diabetes, Metabolic Syndrome and Obesity
spelling doaj-art-47dc8026913e47c2bd16add4bdd786ef2025-08-20T02:24:14ZengDove Medical PressDiabetes, Metabolic Syndrome and Obesity1178-70072025-05-01Volume 18Issue 116711672103116Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter]Gao Y0Fan Z1zhejiang chinese medical universitydeparetment of kidneyYanni Gao,1 Zhenliang Fan2 1The First School of Clinical Medicine, Zhejiang Chinese Medical University, Hangzhou, Zhejiang, 310053, People’s Republic of China; 2The First Affiliated Hospital of Zhejiang Chinese Medical University (Zhejiang Provincial Hospital of Chinese Medicine), Hangzhou, Zhejiang, 310006, People’s Republic of ChinaCorrespondence: Zhenliang Fan, Email fanmlov@sina.cnhttps://www.dovepress.com/redefining-thyroid-hormone-sensitivity-in-diabetic-kidney-disease-a-pa-peer-reviewed-fulltext-article-DMSOBOLD MRISacubitril/valsartanDiabetic kidney diseaseNatriuretic peptide Introduction
spellingShingle Gao Y
Fan Z
Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter]
Diabetes, Metabolic Syndrome and Obesity
BOLD MRI
Sacubitril/valsartan
Diabetic kidney disease
Natriuretic peptide Introduction
title Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter]
title_full Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter]
title_fullStr Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter]
title_full_unstemmed Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter]
title_short Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter]
title_sort redefining thyroid hormone sensitivity in diabetic kidney disease a paradigm shift in pathophysiological understanding letter
topic BOLD MRI
Sacubitril/valsartan
Diabetic kidney disease
Natriuretic peptide Introduction
url https://www.dovepress.com/redefining-thyroid-hormone-sensitivity-in-diabetic-kidney-disease-a-pa-peer-reviewed-fulltext-article-DMSO
work_keys_str_mv AT gaoy redefiningthyroidhormonesensitivityindiabetickidneydiseaseaparadigmshiftinpathophysiologicalunderstandingletter
AT fanz redefiningthyroidhormonesensitivityindiabetickidneydiseaseaparadigmshiftinpathophysiologicalunderstandingletter