Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter]
Yanni Gao,1 Zhenliang Fan2 1The First School of Clinical Medicine, Zhejiang Chinese Medical University, Hangzhou, Zhejiang, 310053, People’s Republic of China; 2The First Affiliated Hospital of Zhejiang Chinese Medical University (Zhejiang Provincial Hospital of Chinese Medicine), Hang...
Saved in:
| Main Authors: | , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Dove Medical Press
2025-05-01
|
| Series: | Diabetes, Metabolic Syndrome and Obesity |
| Subjects: | |
| Online Access: | https://www.dovepress.com/redefining-thyroid-hormone-sensitivity-in-diabetic-kidney-disease-a-pa-peer-reviewed-fulltext-article-DMSO |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850157286369001472 |
|---|---|
| author | Gao Y Fan Z |
| author_facet | Gao Y Fan Z |
| author_sort | Gao Y |
| collection | DOAJ |
| description | Yanni Gao,1 Zhenliang Fan2 1The First School of Clinical Medicine, Zhejiang Chinese Medical University, Hangzhou, Zhejiang, 310053, People’s Republic of China; 2The First Affiliated Hospital of Zhejiang Chinese Medical University (Zhejiang Provincial Hospital of Chinese Medicine), Hangzhou, Zhejiang, 310006, People’s Republic of ChinaCorrespondence: Zhenliang Fan, Email fanmlov@sina.cn |
| format | Article |
| id | doaj-art-47dc8026913e47c2bd16add4bdd786ef |
| institution | OA Journals |
| issn | 1178-7007 |
| language | English |
| publishDate | 2025-05-01 |
| publisher | Dove Medical Press |
| record_format | Article |
| series | Diabetes, Metabolic Syndrome and Obesity |
| spelling | doaj-art-47dc8026913e47c2bd16add4bdd786ef2025-08-20T02:24:14ZengDove Medical PressDiabetes, Metabolic Syndrome and Obesity1178-70072025-05-01Volume 18Issue 116711672103116Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter]Gao Y0Fan Z1zhejiang chinese medical universitydeparetment of kidneyYanni Gao,1 Zhenliang Fan2 1The First School of Clinical Medicine, Zhejiang Chinese Medical University, Hangzhou, Zhejiang, 310053, People’s Republic of China; 2The First Affiliated Hospital of Zhejiang Chinese Medical University (Zhejiang Provincial Hospital of Chinese Medicine), Hangzhou, Zhejiang, 310006, People’s Republic of ChinaCorrespondence: Zhenliang Fan, Email fanmlov@sina.cnhttps://www.dovepress.com/redefining-thyroid-hormone-sensitivity-in-diabetic-kidney-disease-a-pa-peer-reviewed-fulltext-article-DMSOBOLD MRISacubitril/valsartanDiabetic kidney diseaseNatriuretic peptide Introduction |
| spellingShingle | Gao Y Fan Z Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter] Diabetes, Metabolic Syndrome and Obesity BOLD MRI Sacubitril/valsartan Diabetic kidney disease Natriuretic peptide Introduction |
| title | Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter] |
| title_full | Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter] |
| title_fullStr | Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter] |
| title_full_unstemmed | Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter] |
| title_short | Redefining Thyroid Hormone Sensitivity in Diabetic Kidney Disease: A Paradigm Shift in Pathophysiological Understanding [Letter] |
| title_sort | redefining thyroid hormone sensitivity in diabetic kidney disease a paradigm shift in pathophysiological understanding letter |
| topic | BOLD MRI Sacubitril/valsartan Diabetic kidney disease Natriuretic peptide Introduction |
| url | https://www.dovepress.com/redefining-thyroid-hormone-sensitivity-in-diabetic-kidney-disease-a-pa-peer-reviewed-fulltext-article-DMSO |
| work_keys_str_mv | AT gaoy redefiningthyroidhormonesensitivityindiabetickidneydiseaseaparadigmshiftinpathophysiologicalunderstandingletter AT fanz redefiningthyroidhormonesensitivityindiabetickidneydiseaseaparadigmshiftinpathophysiologicalunderstandingletter |