Recent Advances in Identifying Biomarkers and High-Affinity Aptamers for Gynecologic Cancers Diagnosis and Therapy
Cancer is the uncontrollable abnormal division of cell growth, caused due to the varied reasons. Cancer can be expressed in any part of the body, and it is one of the death-causing diseases. Human reproductive organs are commonly damaged by cancer. In particular, the women reproductive system is aff...
Saved in:
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2019-01-01
|
| Series: | Journal of Analytical Methods in Chemistry |
| Online Access: | http://dx.doi.org/10.1155/2019/5426974 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850216530217795584 |
|---|---|
| author | Xiaoqun Ma Thangavel Lakshmipriya Subash C. B. Gopinath |
| author_facet | Xiaoqun Ma Thangavel Lakshmipriya Subash C. B. Gopinath |
| author_sort | Xiaoqun Ma |
| collection | DOAJ |
| description | Cancer is the uncontrollable abnormal division of cell growth, caused due to the varied reasons. Cancer can be expressed in any part of the body, and it is one of the death-causing diseases. Human reproductive organs are commonly damaged by cancer. In particular, the women reproductive system is affected by various cancers including ovarian, cervical, endometrial, vaginal, fallopian tube, and vulvar cancers. Identifying these cancers at earlier stages prevents the damage to the organs. Aptamer is the potential probe that can identify these cancers. Aptamer is an artificial antibody selected from the randomized library of molecules and has a high binding affinity to the target biomarker. Targeting cancers in the reproductive organs using aptamers showed an excellent efficiency of detection compared to other probes. Different aptamers have been generated against the gynaecological cancer biomarkers, which include HE4, CA125, VEGF, OCCA (for ovarian cancer), EGFR, FGFR1, K-ras (for endometrial cancer), HPV E-16, HPV E-7, HPV E-6, tyrosine, and kinase (for cervical cancer), which help to identify the cancers in woman reproductive organs. In this overview, the biomarkers for gynecologic cancers and the relevant diagnosing systems generated using the specific aptamers are discussed. Furthermore, the therapeutic applications of aptamer with gynaecological cancers are narrated. |
| format | Article |
| id | doaj-art-3c1130f19ee34ea98d05a362e995ee72 |
| institution | OA Journals |
| issn | 2090-8865 2090-8873 |
| language | English |
| publishDate | 2019-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | Journal of Analytical Methods in Chemistry |
| spelling | doaj-art-3c1130f19ee34ea98d05a362e995ee722025-08-20T02:08:16ZengWileyJournal of Analytical Methods in Chemistry2090-88652090-88732019-01-01201910.1155/2019/54269745426974Recent Advances in Identifying Biomarkers and High-Affinity Aptamers for Gynecologic Cancers Diagnosis and TherapyXiaoqun Ma0Thangavel Lakshmipriya1Subash C. B. Gopinath2Deparment of Gynecology, Taian City Central Hospital, Taian, Shandong 271000, ChinaInstitute of Nano Electronic Engineering, Universiti Malaysia Perlis, 01000 Kangar, Perlis, MalaysiaInstitute of Nano Electronic Engineering, Universiti Malaysia Perlis, 01000 Kangar, Perlis, MalaysiaCancer is the uncontrollable abnormal division of cell growth, caused due to the varied reasons. Cancer can be expressed in any part of the body, and it is one of the death-causing diseases. Human reproductive organs are commonly damaged by cancer. In particular, the women reproductive system is affected by various cancers including ovarian, cervical, endometrial, vaginal, fallopian tube, and vulvar cancers. Identifying these cancers at earlier stages prevents the damage to the organs. Aptamer is the potential probe that can identify these cancers. Aptamer is an artificial antibody selected from the randomized library of molecules and has a high binding affinity to the target biomarker. Targeting cancers in the reproductive organs using aptamers showed an excellent efficiency of detection compared to other probes. Different aptamers have been generated against the gynaecological cancer biomarkers, which include HE4, CA125, VEGF, OCCA (for ovarian cancer), EGFR, FGFR1, K-ras (for endometrial cancer), HPV E-16, HPV E-7, HPV E-6, tyrosine, and kinase (for cervical cancer), which help to identify the cancers in woman reproductive organs. In this overview, the biomarkers for gynecologic cancers and the relevant diagnosing systems generated using the specific aptamers are discussed. Furthermore, the therapeutic applications of aptamer with gynaecological cancers are narrated.http://dx.doi.org/10.1155/2019/5426974 |
| spellingShingle | Xiaoqun Ma Thangavel Lakshmipriya Subash C. B. Gopinath Recent Advances in Identifying Biomarkers and High-Affinity Aptamers for Gynecologic Cancers Diagnosis and Therapy Journal of Analytical Methods in Chemistry |
| title | Recent Advances in Identifying Biomarkers and High-Affinity Aptamers for Gynecologic Cancers Diagnosis and Therapy |
| title_full | Recent Advances in Identifying Biomarkers and High-Affinity Aptamers for Gynecologic Cancers Diagnosis and Therapy |
| title_fullStr | Recent Advances in Identifying Biomarkers and High-Affinity Aptamers for Gynecologic Cancers Diagnosis and Therapy |
| title_full_unstemmed | Recent Advances in Identifying Biomarkers and High-Affinity Aptamers for Gynecologic Cancers Diagnosis and Therapy |
| title_short | Recent Advances in Identifying Biomarkers and High-Affinity Aptamers for Gynecologic Cancers Diagnosis and Therapy |
| title_sort | recent advances in identifying biomarkers and high affinity aptamers for gynecologic cancers diagnosis and therapy |
| url | http://dx.doi.org/10.1155/2019/5426974 |
| work_keys_str_mv | AT xiaoqunma recentadvancesinidentifyingbiomarkersandhighaffinityaptamersforgynecologiccancersdiagnosisandtherapy AT thangavellakshmipriya recentadvancesinidentifyingbiomarkersandhighaffinityaptamersforgynecologiccancersdiagnosisandtherapy AT subashcbgopinath recentadvancesinidentifyingbiomarkersandhighaffinityaptamersforgynecologiccancersdiagnosisandtherapy |