The effect of parity on the proportion of important healthy fatty acids in raw milk of Holstein cows

The objective of this study was to determine and evaluate the effect of parity on the fatty acids groups’ proportion in Holstein cows’ milk during the first phase of lactations, with an emphasis on its potential importance for consumer health. A total of 25 Holstein cows, 9 primiparous, 9 in the 2nd...

Full description

Saved in:
Bibliographic Details
Main Authors: Luděk Stádník, Jaromír Ducháček, Monika Okrouhlá, Martin Ptáček, Jan Beran, Roman Stupka, Lukáš Zita
Format: Article
Language:English
Published: Croatian Dairy Union 2013-11-01
Series:Mljekarstvo
Subjects:
Online Access:http://hrcak.srce.hr/index.php?show=clanak&id_clanak_jezik=163739
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850105803716952064
author Luděk Stádník
Jaromír Ducháček
Monika Okrouhlá
Martin Ptáček
Jan Beran
Roman Stupka
Lukáš Zita
author_facet Luděk Stádník
Jaromír Ducháček
Monika Okrouhlá
Martin Ptáček
Jan Beran
Roman Stupka
Lukáš Zita
author_sort Luděk Stádník
collection DOAJ
description The objective of this study was to determine and evaluate the effect of parity on the fatty acids groups’ proportion in Holstein cows’ milk during the first phase of lactations, with an emphasis on its potential importance for consumer health. A total of 25 Holstein cows, 9 primiparous, 9 in the 2nd, and 7 in the 3rd and subsequent parity, were observed and sampled at 7-day intervals through the first 17 weeks of lactation. The percentage proportion of saturated (hypercholesterolemic and volatile as its components) and unsaturated (monounsaturated and polyunsaturated as its components) fatty acids in the samples of milk fat (n=425) was determined. The effects of parity and negative energy balance, as well as regression, on the lactation week and the fat to protein ratio were evaluated using SAS 9.3. A significantly (P<0.01) lower proportion of unhealthy hypercholesterolemic fatty acids was detected in primiparous cows (-2.67 %) and those in the 3rd and subsequent lactation (-2.94 %) compared to the 2nd lactation, as well as a simultaneously higher proportion of healthy unsaturated fatty acids (+2.07, respectively +3.08 %). The determined relationships corresponded to organism stress evoked by the initiation of milk production and its maintenance in higher parities. Therefore, the generally required prolongation of dairy cows’ longevity can influence on the quality of raw milk, especially considering composition of fatty acids.
format Article
id doaj-art-388a2a22ebd44814aebf92fc38c722d0
institution OA Journals
issn 0026-704X
1846-4025
language English
publishDate 2013-11-01
publisher Croatian Dairy Union
record_format Article
series Mljekarstvo
spelling doaj-art-388a2a22ebd44814aebf92fc38c722d02025-08-20T02:38:59ZengCroatian Dairy UnionMljekarstvo0026-704X1846-40252013-11-01634195202The effect of parity on the proportion of important healthy fatty acids in raw milk of Holstein cowsLuděk StádníkJaromír DucháčekMonika OkrouhláMartin PtáčekJan BeranRoman StupkaLukáš ZitaThe objective of this study was to determine and evaluate the effect of parity on the fatty acids groups’ proportion in Holstein cows’ milk during the first phase of lactations, with an emphasis on its potential importance for consumer health. A total of 25 Holstein cows, 9 primiparous, 9 in the 2nd, and 7 in the 3rd and subsequent parity, were observed and sampled at 7-day intervals through the first 17 weeks of lactation. The percentage proportion of saturated (hypercholesterolemic and volatile as its components) and unsaturated (monounsaturated and polyunsaturated as its components) fatty acids in the samples of milk fat (n=425) was determined. The effects of parity and negative energy balance, as well as regression, on the lactation week and the fat to protein ratio were evaluated using SAS 9.3. A significantly (P<0.01) lower proportion of unhealthy hypercholesterolemic fatty acids was detected in primiparous cows (-2.67 %) and those in the 3rd and subsequent lactation (-2.94 %) compared to the 2nd lactation, as well as a simultaneously higher proportion of healthy unsaturated fatty acids (+2.07, respectively +3.08 %). The determined relationships corresponded to organism stress evoked by the initiation of milk production and its maintenance in higher parities. Therefore, the generally required prolongation of dairy cows’ longevity can influence on the quality of raw milk, especially considering composition of fatty acids.http://hrcak.srce.hr/index.php?show=clanak&id_clanak_jezik=163739cattlelongevitymilk productionmilk qualitymilk fat composition
spellingShingle Luděk Stádník
Jaromír Ducháček
Monika Okrouhlá
Martin Ptáček
Jan Beran
Roman Stupka
Lukáš Zita
The effect of parity on the proportion of important healthy fatty acids in raw milk of Holstein cows
Mljekarstvo
cattle
longevity
milk production
milk quality
milk fat composition
title The effect of parity on the proportion of important healthy fatty acids in raw milk of Holstein cows
title_full The effect of parity on the proportion of important healthy fatty acids in raw milk of Holstein cows
title_fullStr The effect of parity on the proportion of important healthy fatty acids in raw milk of Holstein cows
title_full_unstemmed The effect of parity on the proportion of important healthy fatty acids in raw milk of Holstein cows
title_short The effect of parity on the proportion of important healthy fatty acids in raw milk of Holstein cows
title_sort effect of parity on the proportion of important healthy fatty acids in raw milk of holstein cows
topic cattle
longevity
milk production
milk quality
milk fat composition
url http://hrcak.srce.hr/index.php?show=clanak&id_clanak_jezik=163739
work_keys_str_mv AT ludekstadnik theeffectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT jaromirduchacek theeffectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT monikaokrouhla theeffectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT martinptacek theeffectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT janberan theeffectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT romanstupka theeffectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT lukaszita theeffectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT ludekstadnik effectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT jaromirduchacek effectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT monikaokrouhla effectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT martinptacek effectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT janberan effectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT romanstupka effectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows
AT lukaszita effectofparityontheproportionofimportanthealthyfattyacidsinrawmilkofholsteincows