Identification of Y-box binding protein 1 as a core regulator of MEK/ERK pathway-dependent gene signatures in colorectal cancer cells.

Transcriptional signatures are an indispensible source of correlative information on disease-related molecular alterations on a genome-wide level. Numerous candidate genes involved in disease and in factors of predictive, as well as of prognostic, value have been deduced from such molecular portrait...

Full description

Saved in:
Bibliographic Details
Main Authors: Karsten Jürchott, Ralf-Jürgen Kuban, Till Krech, Nils Blüthgen, Ulrike Stein, Wolfgang Walther, Christian Friese, Szymon M Kiełbasa, Ute Ungethüm, Per Lund, Thomas Knösel, Wolfgang Kemmner, Markus Morkel, Johannes Fritzmann, Peter M Schlag, Walter Birchmeier, Tammo Krueger, Silke Sperling, Christine Sers, Hans-Dieter Royer, Hanspeter Herzel, Reinhold Schäfer
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2010-12-01
Series:PLoS Genetics
Online Access:https://journals.plos.org/plosgenetics/article/file?id=10.1371/journal.pgen.1001231&type=printable
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850025037001654272
author Karsten Jürchott
Ralf-Jürgen Kuban
Till Krech
Nils Blüthgen
Ulrike Stein
Wolfgang Walther
Christian Friese
Szymon M Kiełbasa
Ute Ungethüm
Per Lund
Thomas Knösel
Wolfgang Kemmner
Markus Morkel
Johannes Fritzmann
Peter M Schlag
Walter Birchmeier
Tammo Krueger
Silke Sperling
Christine Sers
Hans-Dieter Royer
Hanspeter Herzel
Reinhold Schäfer
author_facet Karsten Jürchott
Ralf-Jürgen Kuban
Till Krech
Nils Blüthgen
Ulrike Stein
Wolfgang Walther
Christian Friese
Szymon M Kiełbasa
Ute Ungethüm
Per Lund
Thomas Knösel
Wolfgang Kemmner
Markus Morkel
Johannes Fritzmann
Peter M Schlag
Walter Birchmeier
Tammo Krueger
Silke Sperling
Christine Sers
Hans-Dieter Royer
Hanspeter Herzel
Reinhold Schäfer
author_sort Karsten Jürchott
collection DOAJ
description Transcriptional signatures are an indispensible source of correlative information on disease-related molecular alterations on a genome-wide level. Numerous candidate genes involved in disease and in factors of predictive, as well as of prognostic, value have been deduced from such molecular portraits, e.g. in cancer. However, mechanistic insights into the regulatory principles governing global transcriptional changes are lagging behind extensive compilations of deregulated genes. To identify regulators of transcriptome alterations, we used an integrated approach combining transcriptional profiling of colorectal cancer cell lines treated with inhibitors targeting the receptor tyrosine kinase (RTK)/RAS/mitogen-activated protein kinase pathway, computational prediction of regulatory elements in promoters of co-regulated genes, chromatin-based and functional cellular assays. We identified commonly co-regulated, proliferation-associated target genes that respond to the MAPK pathway. We recognized E2F and NFY transcription factor binding sites as prevalent motifs in those pathway-responsive genes and confirmed the predicted regulatory role of Y-box binding protein 1 (YBX1) by reporter gene, gel shift, and chromatin immunoprecipitation assays. We also validated the MAPK-dependent gene signature in colorectal cancers and provided evidence for the association of YBX1 with poor prognosis in colorectal cancer patients. This suggests that MEK/ERK-dependent, YBX1-regulated target genes are involved in executing malignant properties.
format Article
id doaj-art-374dde0b6ad640c3b6dc0984ca6ebe07
institution DOAJ
issn 1553-7390
1553-7404
language English
publishDate 2010-12-01
publisher Public Library of Science (PLoS)
record_format Article
series PLoS Genetics
spelling doaj-art-374dde0b6ad640c3b6dc0984ca6ebe072025-08-20T03:00:57ZengPublic Library of Science (PLoS)PLoS Genetics1553-73901553-74042010-12-01612e100123110.1371/journal.pgen.1001231Identification of Y-box binding protein 1 as a core regulator of MEK/ERK pathway-dependent gene signatures in colorectal cancer cells.Karsten JürchottRalf-Jürgen KubanTill KrechNils BlüthgenUlrike SteinWolfgang WaltherChristian FrieseSzymon M KiełbasaUte UngethümPer LundThomas KnöselWolfgang KemmnerMarkus MorkelJohannes FritzmannPeter M SchlagWalter BirchmeierTammo KruegerSilke SperlingChristine SersHans-Dieter RoyerHanspeter HerzelReinhold SchäferTranscriptional signatures are an indispensible source of correlative information on disease-related molecular alterations on a genome-wide level. Numerous candidate genes involved in disease and in factors of predictive, as well as of prognostic, value have been deduced from such molecular portraits, e.g. in cancer. However, mechanistic insights into the regulatory principles governing global transcriptional changes are lagging behind extensive compilations of deregulated genes. To identify regulators of transcriptome alterations, we used an integrated approach combining transcriptional profiling of colorectal cancer cell lines treated with inhibitors targeting the receptor tyrosine kinase (RTK)/RAS/mitogen-activated protein kinase pathway, computational prediction of regulatory elements in promoters of co-regulated genes, chromatin-based and functional cellular assays. We identified commonly co-regulated, proliferation-associated target genes that respond to the MAPK pathway. We recognized E2F and NFY transcription factor binding sites as prevalent motifs in those pathway-responsive genes and confirmed the predicted regulatory role of Y-box binding protein 1 (YBX1) by reporter gene, gel shift, and chromatin immunoprecipitation assays. We also validated the MAPK-dependent gene signature in colorectal cancers and provided evidence for the association of YBX1 with poor prognosis in colorectal cancer patients. This suggests that MEK/ERK-dependent, YBX1-regulated target genes are involved in executing malignant properties.https://journals.plos.org/plosgenetics/article/file?id=10.1371/journal.pgen.1001231&type=printable
spellingShingle Karsten Jürchott
Ralf-Jürgen Kuban
Till Krech
Nils Blüthgen
Ulrike Stein
Wolfgang Walther
Christian Friese
Szymon M Kiełbasa
Ute Ungethüm
Per Lund
Thomas Knösel
Wolfgang Kemmner
Markus Morkel
Johannes Fritzmann
Peter M Schlag
Walter Birchmeier
Tammo Krueger
Silke Sperling
Christine Sers
Hans-Dieter Royer
Hanspeter Herzel
Reinhold Schäfer
Identification of Y-box binding protein 1 as a core regulator of MEK/ERK pathway-dependent gene signatures in colorectal cancer cells.
PLoS Genetics
title Identification of Y-box binding protein 1 as a core regulator of MEK/ERK pathway-dependent gene signatures in colorectal cancer cells.
title_full Identification of Y-box binding protein 1 as a core regulator of MEK/ERK pathway-dependent gene signatures in colorectal cancer cells.
title_fullStr Identification of Y-box binding protein 1 as a core regulator of MEK/ERK pathway-dependent gene signatures in colorectal cancer cells.
title_full_unstemmed Identification of Y-box binding protein 1 as a core regulator of MEK/ERK pathway-dependent gene signatures in colorectal cancer cells.
title_short Identification of Y-box binding protein 1 as a core regulator of MEK/ERK pathway-dependent gene signatures in colorectal cancer cells.
title_sort identification of y box binding protein 1 as a core regulator of mek erk pathway dependent gene signatures in colorectal cancer cells
url https://journals.plos.org/plosgenetics/article/file?id=10.1371/journal.pgen.1001231&type=printable
work_keys_str_mv AT karstenjurchott identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT ralfjurgenkuban identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT tillkrech identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT nilsbluthgen identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT ulrikestein identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT wolfgangwalther identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT christianfriese identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT szymonmkiełbasa identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT uteungethum identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT perlund identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT thomasknosel identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT wolfgangkemmner identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT markusmorkel identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT johannesfritzmann identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT petermschlag identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT walterbirchmeier identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT tammokrueger identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT silkesperling identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT christinesers identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT hansdieterroyer identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT hanspeterherzel identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells
AT reinholdschafer identificationofyboxbindingprotein1asacoreregulatorofmekerkpathwaydependentgenesignaturesincolorectalcancercells