Non-catalytic and catalytic co-pyrolysis of neem seed cake and plastic waste: an experimental investigation on product distribution, synergistic interaction and characterization
Abstract This investigation elucidates the co-pyrolysis of neem seed cake in combination with plastic waste across a spectrum of mass ratios namely, 0:1, 3:1, 2:1, 1:1, 1:2, 1:3, and 1:0 subjected to varying pyrolytic temperatures from 350°C to 650°C, employing a CuO catalyst as a facilitating agent...
Saved in:
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Academia Brasileira de Ciências
2025-05-01
|
| Series: | Anais da Academia Brasileira de Ciências |
| Subjects: | |
| Online Access: | http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0001-37652025000200507&lng=en&tlng=en |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849326376481456128 |
|---|---|
| author | THOMAS P. STEPHEN LIVINGSTON PETCHIMUTHU MADHU CHANDRASEKARAN SOWMYA DHANALAKSHMI VADIVEL AYYAKKANNU |
| author_facet | THOMAS P. STEPHEN LIVINGSTON PETCHIMUTHU MADHU CHANDRASEKARAN SOWMYA DHANALAKSHMI VADIVEL AYYAKKANNU |
| author_sort | THOMAS P. STEPHEN LIVINGSTON |
| collection | DOAJ |
| description | Abstract This investigation elucidates the co-pyrolysis of neem seed cake in combination with plastic waste across a spectrum of mass ratios namely, 0:1, 3:1, 2:1, 1:1, 1:2, 1:3, and 1:0 subjected to varying pyrolytic temperatures from 350°C to 650°C, employing a CuO catalyst as a facilitating agent. The research concentrated on elucidating the effect of reaction temperature and the blend ratio of neem seed cake to plastic waste on the distribution of products and the chemical composition of the resultant pyrolysis oil. The co-pyrolysis performed at a 1:2 ratio of neem seed cake to plastic waste yielded an optimal oil production of 69.4 wt% with maximum positive synergy of 6.25% at 500°C. The physicochemical characteristics of the resulting co-pyrolysis oil demonstrated a striking resemblance to those of conventional fossil diesel. Further analysis through FT-IR revealed the presence of a different range of aromatic components. Quantitative analysis utilizing chromatographic peak area evaluations was undertaken to elucidate the compositional profile of the pyrolysis oils, thereby accentuating the presence of synergistic effects. Furthermore, GC-MS analysis provided empirical validation of the interaction between neem seed cake and waste plastics during co-pyrolysis, as indicated by discernible decrease in the concentration of oxygenated compounds. |
| format | Article |
| id | doaj-art-3429698c4c384f0cb4dfc5bc5ac33a05 |
| institution | Kabale University |
| issn | 1678-2690 |
| language | English |
| publishDate | 2025-05-01 |
| publisher | Academia Brasileira de Ciências |
| record_format | Article |
| series | Anais da Academia Brasileira de Ciências |
| spelling | doaj-art-3429698c4c384f0cb4dfc5bc5ac33a052025-08-20T03:48:10ZengAcademia Brasileira de CiênciasAnais da Academia Brasileira de Ciências1678-26902025-05-0197210.1590/0001-3765202520241284Non-catalytic and catalytic co-pyrolysis of neem seed cake and plastic waste: an experimental investigation on product distribution, synergistic interaction and characterizationTHOMAS P. STEPHEN LIVINGSTONhttps://orcid.org/0000-0001-6314-8123PETCHIMUTHU MADHUhttps://orcid.org/0000-0001-8599-219XCHANDRASEKARAN SOWMYA DHANALAKSHMIhttps://orcid.org/0000-0002-9471-9889VADIVEL AYYAKKANNUhttps://orcid.org/0000-0003-4817-0239Abstract This investigation elucidates the co-pyrolysis of neem seed cake in combination with plastic waste across a spectrum of mass ratios namely, 0:1, 3:1, 2:1, 1:1, 1:2, 1:3, and 1:0 subjected to varying pyrolytic temperatures from 350°C to 650°C, employing a CuO catalyst as a facilitating agent. The research concentrated on elucidating the effect of reaction temperature and the blend ratio of neem seed cake to plastic waste on the distribution of products and the chemical composition of the resultant pyrolysis oil. The co-pyrolysis performed at a 1:2 ratio of neem seed cake to plastic waste yielded an optimal oil production of 69.4 wt% with maximum positive synergy of 6.25% at 500°C. The physicochemical characteristics of the resulting co-pyrolysis oil demonstrated a striking resemblance to those of conventional fossil diesel. Further analysis through FT-IR revealed the presence of a different range of aromatic components. Quantitative analysis utilizing chromatographic peak area evaluations was undertaken to elucidate the compositional profile of the pyrolysis oils, thereby accentuating the presence of synergistic effects. Furthermore, GC-MS analysis provided empirical validation of the interaction between neem seed cake and waste plastics during co-pyrolysis, as indicated by discernible decrease in the concentration of oxygenated compounds.http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0001-37652025000200507&lng=en&tlng=enBiofuelcharacterizationco-pyrolysismixed plasticsneem seed cake |
| spellingShingle | THOMAS P. STEPHEN LIVINGSTON PETCHIMUTHU MADHU CHANDRASEKARAN SOWMYA DHANALAKSHMI VADIVEL AYYAKKANNU Non-catalytic and catalytic co-pyrolysis of neem seed cake and plastic waste: an experimental investigation on product distribution, synergistic interaction and characterization Anais da Academia Brasileira de Ciências Biofuel characterization co-pyrolysis mixed plastics neem seed cake |
| title | Non-catalytic and catalytic co-pyrolysis of neem seed cake and plastic waste: an experimental investigation on product distribution, synergistic interaction and characterization |
| title_full | Non-catalytic and catalytic co-pyrolysis of neem seed cake and plastic waste: an experimental investigation on product distribution, synergistic interaction and characterization |
| title_fullStr | Non-catalytic and catalytic co-pyrolysis of neem seed cake and plastic waste: an experimental investigation on product distribution, synergistic interaction and characterization |
| title_full_unstemmed | Non-catalytic and catalytic co-pyrolysis of neem seed cake and plastic waste: an experimental investigation on product distribution, synergistic interaction and characterization |
| title_short | Non-catalytic and catalytic co-pyrolysis of neem seed cake and plastic waste: an experimental investigation on product distribution, synergistic interaction and characterization |
| title_sort | non catalytic and catalytic co pyrolysis of neem seed cake and plastic waste an experimental investigation on product distribution synergistic interaction and characterization |
| topic | Biofuel characterization co-pyrolysis mixed plastics neem seed cake |
| url | http://www.scielo.br/scielo.php?script=sci_arttext&pid=S0001-37652025000200507&lng=en&tlng=en |
| work_keys_str_mv | AT thomaspstephenlivingston noncatalyticandcatalyticcopyrolysisofneemseedcakeandplasticwasteanexperimentalinvestigationonproductdistributionsynergisticinteractionandcharacterization AT petchimuthumadhu noncatalyticandcatalyticcopyrolysisofneemseedcakeandplasticwasteanexperimentalinvestigationonproductdistributionsynergisticinteractionandcharacterization AT chandrasekaransowmyadhanalakshmi noncatalyticandcatalyticcopyrolysisofneemseedcakeandplasticwasteanexperimentalinvestigationonproductdistributionsynergisticinteractionandcharacterization AT vadivelayyakkannu noncatalyticandcatalyticcopyrolysisofneemseedcakeandplasticwasteanexperimentalinvestigationonproductdistributionsynergisticinteractionandcharacterization |