Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions
Objectives To systematically review existing literature on hospital-based quality improvement studies in sub-Saharan Africa that aim to improve surgical and anaesthesia care, capturing clinical, process and implementation outcomes in order to evaluate the impact of the intervention and implementatio...
Saved in:
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
BMJ Publishing Group
2022-10-01
|
| Series: | BMJ Open |
| Online Access: | https://bmjopen.bmj.com/content/12/10/e062616.full |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1823857336858443776 |
|---|---|
| author | Justine Davies Nataliya Brima Imran O Morhason-Bello Andy JM Leather Vandy Charles |
| author_facet | Justine Davies Nataliya Brima Imran O Morhason-Bello Andy JM Leather Vandy Charles |
| author_sort | Justine Davies |
| collection | DOAJ |
| description | Objectives To systematically review existing literature on hospital-based quality improvement studies in sub-Saharan Africa that aim to improve surgical and anaesthesia care, capturing clinical, process and implementation outcomes in order to evaluate the impact of the intervention and implementation learning.Design We conducted a systematic literature review and narrative synthesis.Setting Literature on hospital-based quality improvement studies in sub-Saharan Africa reviewed until 31 December 2021.Participants MEDLINE, EMBASE, Global Health, CINAHL, Web of Science databases and grey literature were searched.Intervention We extracted data on intervention characteristics and how the intervention was delivered and evaluated.Primary and secondary outcome measures Importantly, we assessed whether clinical, process and implementation outcomes were collected and separately categorised the outcomes under the Institute of Medicine quality domains. Risk of bias was not assessed.Results Of 1573 articles identified, 49 were included from 17/48 sub-Saharan African countries, 16 of which were low-income or lower middle-income countries. Almost two-thirds of the studies took place in East Africa (31/49, 63.2%). The most common intervention focus was reduction of surgical site infection (12/49, 24.5%) and use of a surgical safety checklist (14/49, 28.6%). Use of implementation and quality improvement science methods were rare. Over half the studies measured clinical outcomes (29/49, 59.2%), with the most commonly reported ones being perioperative mortality (13/29, 44.8%) and surgical site infection rate (14/29, 48.3%). Process and implementation outcomes were reported in over two thirds of the studies (34/49, 69.4% and 35, 71.4%, respectively). The most studied quality domain was safety (44/49, 89.8%), with efficiency (4/49, 8.2%) and equitability (2/49, 4.1%) the least studied domains.Conclusions There are few hospital-based studies that focus on improving the quality of surgical and anaesthesia care in sub-Saharan Africa. Use of implementation and quality improvement methodologies remain low, and some quality domains are neglected.PROSPERO registration number CRD42019125570 |
| format | Article |
| id | doaj-art-31f65387d85a4e9997ee11b3f7a9c68f |
| institution | Kabale University |
| issn | 2044-6055 |
| language | English |
| publishDate | 2022-10-01 |
| publisher | BMJ Publishing Group |
| record_format | Article |
| series | BMJ Open |
| spelling | doaj-art-31f65387d85a4e9997ee11b3f7a9c68f2025-02-11T21:25:09ZengBMJ Publishing GroupBMJ Open2044-60552022-10-01121010.1136/bmjopen-2022-062616Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventionsJustine Davies0Nataliya Brima1Imran O Morhason-Bello2Andy JM Leather3Vandy Charles4University of Birmingham Institute of Applied Health Research, Birmingham, UKKing’s Centre for Global Health and Health Partnerships, School of Life Course and Population Sciences, King`s College London, London, UKHPV Research Consortium, College of Medicine, University of Ibadan, Ibadan, Oyo State, NigeriaCentre for Global Health Partnerships, King`s College London, London, UKStatistics Sierra Leone, Freetown, Sierra LeoneObjectives To systematically review existing literature on hospital-based quality improvement studies in sub-Saharan Africa that aim to improve surgical and anaesthesia care, capturing clinical, process and implementation outcomes in order to evaluate the impact of the intervention and implementation learning.Design We conducted a systematic literature review and narrative synthesis.Setting Literature on hospital-based quality improvement studies in sub-Saharan Africa reviewed until 31 December 2021.Participants MEDLINE, EMBASE, Global Health, CINAHL, Web of Science databases and grey literature were searched.Intervention We extracted data on intervention characteristics and how the intervention was delivered and evaluated.Primary and secondary outcome measures Importantly, we assessed whether clinical, process and implementation outcomes were collected and separately categorised the outcomes under the Institute of Medicine quality domains. Risk of bias was not assessed.Results Of 1573 articles identified, 49 were included from 17/48 sub-Saharan African countries, 16 of which were low-income or lower middle-income countries. Almost two-thirds of the studies took place in East Africa (31/49, 63.2%). The most common intervention focus was reduction of surgical site infection (12/49, 24.5%) and use of a surgical safety checklist (14/49, 28.6%). Use of implementation and quality improvement science methods were rare. Over half the studies measured clinical outcomes (29/49, 59.2%), with the most commonly reported ones being perioperative mortality (13/29, 44.8%) and surgical site infection rate (14/29, 48.3%). Process and implementation outcomes were reported in over two thirds of the studies (34/49, 69.4% and 35, 71.4%, respectively). The most studied quality domain was safety (44/49, 89.8%), with efficiency (4/49, 8.2%) and equitability (2/49, 4.1%) the least studied domains.Conclusions There are few hospital-based studies that focus on improving the quality of surgical and anaesthesia care in sub-Saharan Africa. Use of implementation and quality improvement methodologies remain low, and some quality domains are neglected.PROSPERO registration number CRD42019125570https://bmjopen.bmj.com/content/12/10/e062616.full |
| spellingShingle | Justine Davies Nataliya Brima Imran O Morhason-Bello Andy JM Leather Vandy Charles Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions BMJ Open |
| title | Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions |
| title_full | Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions |
| title_fullStr | Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions |
| title_full_unstemmed | Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions |
| title_short | Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions |
| title_sort | improving quality of surgical and anaesthesia care in sub saharan africa a systematic review of hospital based quality improvement interventions |
| url | https://bmjopen.bmj.com/content/12/10/e062616.full |
| work_keys_str_mv | AT justinedavies improvingqualityofsurgicalandanaesthesiacareinsubsaharanafricaasystematicreviewofhospitalbasedqualityimprovementinterventions AT nataliyabrima improvingqualityofsurgicalandanaesthesiacareinsubsaharanafricaasystematicreviewofhospitalbasedqualityimprovementinterventions AT imranomorhasonbello improvingqualityofsurgicalandanaesthesiacareinsubsaharanafricaasystematicreviewofhospitalbasedqualityimprovementinterventions AT andyjmleather improvingqualityofsurgicalandanaesthesiacareinsubsaharanafricaasystematicreviewofhospitalbasedqualityimprovementinterventions AT vandycharles improvingqualityofsurgicalandanaesthesiacareinsubsaharanafricaasystematicreviewofhospitalbasedqualityimprovementinterventions |