Identification of genes associated with resistance trait to VPAHPND in Pacific white shrimp (Litopenaeus vannamei) using Bulk Segregation Analysis (BSA)
Vibrio parahaemolyticus harboring the PirA/PirB toxin (VPAHPND) is regarded as one of the main pathogens that caused Acute hepatopancreatic necrosis disease (AHPND) in the Pacific white shrimp Litopenaeus vannamei (L. vannamei). Breeding new varieties resistant to VPAHPND is considered to be the mos...
Saved in:
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Elsevier
2025-09-01
|
| Series: | Aquaculture Reports |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S2352513425002881 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849335599202304000 |
|---|---|
| author | Zhenning Bao Yang Yu Pengfei Lin Fuhua Li |
| author_facet | Zhenning Bao Yang Yu Pengfei Lin Fuhua Li |
| author_sort | Zhenning Bao |
| collection | DOAJ |
| description | Vibrio parahaemolyticus harboring the PirA/PirB toxin (VPAHPND) is regarded as one of the main pathogens that caused Acute hepatopancreatic necrosis disease (AHPND) in the Pacific white shrimp Litopenaeus vannamei (L. vannamei). Breeding new varieties resistant to VPAHPND is considered to be the most effective way to reduce the economic losses in shrimp aquaculture. Identification of genes and SNP markers associated with resistance trait could accelerate the breeding efficiency by application of marker assisted selection and genomic selection. In the present study, a Bulk Segregation Analysis coupled to whole genome sequencing method was employed to identify SNPs and genes associated with resistance trait to VPAHPND in L. vannamei. The DNA of susceptible and resistant individuals was pooled separately. ED (Euclidean distance) and the chi-square test were applied to calculate the allele frequency and genotype frequency differences between susceptible and resistant individuals. A total of 2238 SNPs and 97 genes were identified to be associated with resistance trait to VPAHPND. KEGG enrichment analysis showed that these genes were significantly enriched in PPAR signaling pathway, PI3K-Akt signaling pathway, NLR pathway and O-Antigen nucleotide sugar biosynthesis pathway. The acyl-CoA delta-9 desaturase gene, 14–3–3 epsilon-like gene, retrovirus-related Pol polyprotein gene, enzymatic polyprotein gene in these pathways were considered as candidate genes associated with resistance trait to VPAHPND of shrimp. This study demonstrated that BSA based on whole genome re-sequencing was a cost-effective method for identifying disease resistant genes in aquaculture animals. These data will not only provide useful information for understanding the genetic basis of shrimp resistance trait to VPAHPND, but also offer a source of SNPs for marker-assisted selection and genomic selection in shrimp breeding. |
| format | Article |
| id | doaj-art-2b2dd822bf724353ba28f8b26487915b |
| institution | Kabale University |
| issn | 2352-5134 |
| language | English |
| publishDate | 2025-09-01 |
| publisher | Elsevier |
| record_format | Article |
| series | Aquaculture Reports |
| spelling | doaj-art-2b2dd822bf724353ba28f8b26487915b2025-08-20T03:45:12ZengElsevierAquaculture Reports2352-51342025-09-014310290210.1016/j.aqrep.2025.102902Identification of genes associated with resistance trait to VPAHPND in Pacific white shrimp (Litopenaeus vannamei) using Bulk Segregation Analysis (BSA)Zhenning Bao0Yang Yu1Pengfei Lin2Fuhua Li3State Key Laboratory of Breeding Biotechnology and Sustainable Aquaculture, Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266000, China; University of Chinese Academy of Sciences, Beijing 100049, ChinaState Key Laboratory of Breeding Biotechnology and Sustainable Aquaculture, Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266000, China; Laboratory for Marine Biology and Biotechnology, Qingdao Marine Science and Technology Center, Qingdao 266071, China; University of Chinese Academy of Sciences, Beijing 100049, China; Corresponding authors at: State Key Laboratory of Breeding Biotechnology and Sustainable Aquaculture, Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266000, China.State Key Laboratory of Breeding Biotechnology and Sustainable Aquaculture, Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266000, China; University of Chinese Academy of Sciences, Beijing 100049, ChinaState Key Laboratory of Breeding Biotechnology and Sustainable Aquaculture, Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266000, China; Laboratory for Marine Biology and Biotechnology, Qingdao Marine Science and Technology Center, Qingdao 266071, China; University of Chinese Academy of Sciences, Beijing 100049, China; Corresponding authors at: State Key Laboratory of Breeding Biotechnology and Sustainable Aquaculture, Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266000, China.Vibrio parahaemolyticus harboring the PirA/PirB toxin (VPAHPND) is regarded as one of the main pathogens that caused Acute hepatopancreatic necrosis disease (AHPND) in the Pacific white shrimp Litopenaeus vannamei (L. vannamei). Breeding new varieties resistant to VPAHPND is considered to be the most effective way to reduce the economic losses in shrimp aquaculture. Identification of genes and SNP markers associated with resistance trait could accelerate the breeding efficiency by application of marker assisted selection and genomic selection. In the present study, a Bulk Segregation Analysis coupled to whole genome sequencing method was employed to identify SNPs and genes associated with resistance trait to VPAHPND in L. vannamei. The DNA of susceptible and resistant individuals was pooled separately. ED (Euclidean distance) and the chi-square test were applied to calculate the allele frequency and genotype frequency differences between susceptible and resistant individuals. A total of 2238 SNPs and 97 genes were identified to be associated with resistance trait to VPAHPND. KEGG enrichment analysis showed that these genes were significantly enriched in PPAR signaling pathway, PI3K-Akt signaling pathway, NLR pathway and O-Antigen nucleotide sugar biosynthesis pathway. The acyl-CoA delta-9 desaturase gene, 14–3–3 epsilon-like gene, retrovirus-related Pol polyprotein gene, enzymatic polyprotein gene in these pathways were considered as candidate genes associated with resistance trait to VPAHPND of shrimp. This study demonstrated that BSA based on whole genome re-sequencing was a cost-effective method for identifying disease resistant genes in aquaculture animals. These data will not only provide useful information for understanding the genetic basis of shrimp resistance trait to VPAHPND, but also offer a source of SNPs for marker-assisted selection and genomic selection in shrimp breeding.http://www.sciencedirect.com/science/article/pii/S2352513425002881Litopenaeus vannameiBulk Segregation Analysis (BSA)Resistance to VPAHPNDSingle nucleotide polymorphisms (SNPs)Sliding window algorithm |
| spellingShingle | Zhenning Bao Yang Yu Pengfei Lin Fuhua Li Identification of genes associated with resistance trait to VPAHPND in Pacific white shrimp (Litopenaeus vannamei) using Bulk Segregation Analysis (BSA) Aquaculture Reports Litopenaeus vannamei Bulk Segregation Analysis (BSA) Resistance to VPAHPND Single nucleotide polymorphisms (SNPs) Sliding window algorithm |
| title | Identification of genes associated with resistance trait to VPAHPND in Pacific white shrimp (Litopenaeus vannamei) using Bulk Segregation Analysis (BSA) |
| title_full | Identification of genes associated with resistance trait to VPAHPND in Pacific white shrimp (Litopenaeus vannamei) using Bulk Segregation Analysis (BSA) |
| title_fullStr | Identification of genes associated with resistance trait to VPAHPND in Pacific white shrimp (Litopenaeus vannamei) using Bulk Segregation Analysis (BSA) |
| title_full_unstemmed | Identification of genes associated with resistance trait to VPAHPND in Pacific white shrimp (Litopenaeus vannamei) using Bulk Segregation Analysis (BSA) |
| title_short | Identification of genes associated with resistance trait to VPAHPND in Pacific white shrimp (Litopenaeus vannamei) using Bulk Segregation Analysis (BSA) |
| title_sort | identification of genes associated with resistance trait to vpahpnd in pacific white shrimp litopenaeus vannamei using bulk segregation analysis bsa |
| topic | Litopenaeus vannamei Bulk Segregation Analysis (BSA) Resistance to VPAHPND Single nucleotide polymorphisms (SNPs) Sliding window algorithm |
| url | http://www.sciencedirect.com/science/article/pii/S2352513425002881 |
| work_keys_str_mv | AT zhenningbao identificationofgenesassociatedwithresistancetraittovpahpndinpacificwhiteshrimplitopenaeusvannameiusingbulksegregationanalysisbsa AT yangyu identificationofgenesassociatedwithresistancetraittovpahpndinpacificwhiteshrimplitopenaeusvannameiusingbulksegregationanalysisbsa AT pengfeilin identificationofgenesassociatedwithresistancetraittovpahpndinpacificwhiteshrimplitopenaeusvannameiusingbulksegregationanalysisbsa AT fuhuali identificationofgenesassociatedwithresistancetraittovpahpndinpacificwhiteshrimplitopenaeusvannameiusingbulksegregationanalysisbsa |