Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators
In this paper, the extended form of the modified Atangana–Baleanu (A-B) Caputo fractional operators (FOs) is introduced and their properties and applications are demonstrated. Some fractional differential equations are formulated using the novel operators and are solved through the generalized Lapla...
Saved in:
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Elsevier
2025-09-01
|
| Series: | Alexandria Engineering Journal |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S1110016825008087 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849248159285379072 |
|---|---|
| author | Ahsan Mehmood Muhammad Samraiz Zhi-Guo Liu Miguel Vivas-Cortez |
| author_facet | Ahsan Mehmood Muhammad Samraiz Zhi-Guo Liu Miguel Vivas-Cortez |
| author_sort | Ahsan Mehmood |
| collection | DOAJ |
| description | In this paper, the extended form of the modified Atangana–Baleanu (A-B) Caputo fractional operators (FOs) is introduced and their properties and applications are demonstrated. Some fractional differential equations are formulated using the novel operators and are solved through the generalized Laplace transform. The fractional differential equations of electromagnetic waves in plasma are analyzed using the newly defined operators with applications observed in various scientific fields. The behavior of electromagnetic waves in plasma is studied for different fractional orders and parameter values and the results are presented in the form of tables as well as 2D and 3D graphs. Changes in wavelength for various domain values and fractional orders are computed based on these graphs and tables. The relationship between the newly defined operators and those existing in the literature is examined and it is concluded that the introduced operators are more generalized than the previously established ones. |
| format | Article |
| id | doaj-art-2a60711b315d4873aaf99add979fbe49 |
| institution | Kabale University |
| issn | 1110-0168 |
| language | English |
| publishDate | 2025-09-01 |
| publisher | Elsevier |
| record_format | Article |
| series | Alexandria Engineering Journal |
| spelling | doaj-art-2a60711b315d4873aaf99add979fbe492025-08-20T03:58:00ZengElsevierAlexandria Engineering Journal1110-01682025-09-0112885286610.1016/j.aej.2025.06.058Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operatorsAhsan Mehmood0Muhammad Samraiz1Zhi-Guo Liu2Miguel Vivas-Cortez3School of Mathematical Sciences and Shanghai Key Laboratory PMMP, East China Normal University, 500 Dongchuan Road, Shanghai, 200241, ChinaDepartment of Mathematics, University of Sargodha, P.O. Box 40100, Sargodha, PakistanSchool of Mathematical Sciences and Shanghai Key Laboratory PMMP, East China Normal University, 500 Dongchuan Road, Shanghai, 200241, ChinaPontificia Universidad Católica del Ecuador, Facultad de Ciencias Exactas, Naturales y Ambientales, FRACTAL (Fractional Research Convexity Analysis and Their Laboratory Applications), Ecuador; Corresponding author.In this paper, the extended form of the modified Atangana–Baleanu (A-B) Caputo fractional operators (FOs) is introduced and their properties and applications are demonstrated. Some fractional differential equations are formulated using the novel operators and are solved through the generalized Laplace transform. The fractional differential equations of electromagnetic waves in plasma are analyzed using the newly defined operators with applications observed in various scientific fields. The behavior of electromagnetic waves in plasma is studied for different fractional orders and parameter values and the results are presented in the form of tables as well as 2D and 3D graphs. Changes in wavelength for various domain values and fractional orders are computed based on these graphs and tables. The relationship between the newly defined operators and those existing in the literature is examined and it is concluded that the introduced operators are more generalized than the previously established ones.http://www.sciencedirect.com/science/article/pii/S1110016825008087Fractional operatorsMittag-Leffler functionGeneralized Laplace transformFractional differential equation |
| spellingShingle | Ahsan Mehmood Muhammad Samraiz Zhi-Guo Liu Miguel Vivas-Cortez Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators Alexandria Engineering Journal Fractional operators Mittag-Leffler function Generalized Laplace transform Fractional differential equation |
| title | Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators |
| title_full | Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators |
| title_fullStr | Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators |
| title_full_unstemmed | Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators |
| title_short | Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators |
| title_sort | uniqueness property of the generalized laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators |
| topic | Fractional operators Mittag-Leffler function Generalized Laplace transform Fractional differential equation |
| url | http://www.sciencedirect.com/science/article/pii/S1110016825008087 |
| work_keys_str_mv | AT ahsanmehmood uniquenesspropertyofthegeneralizedlaplacetransformandcomputationalvisualizationofelectromagneticwavesinplasmaviafractionaloperators AT muhammadsamraiz uniquenesspropertyofthegeneralizedlaplacetransformandcomputationalvisualizationofelectromagneticwavesinplasmaviafractionaloperators AT zhiguoliu uniquenesspropertyofthegeneralizedlaplacetransformandcomputationalvisualizationofelectromagneticwavesinplasmaviafractionaloperators AT miguelvivascortez uniquenesspropertyofthegeneralizedlaplacetransformandcomputationalvisualizationofelectromagneticwavesinplasmaviafractionaloperators |