Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators

In this paper, the extended form of the modified Atangana–Baleanu (A-B) Caputo fractional operators (FOs) is introduced and their properties and applications are demonstrated. Some fractional differential equations are formulated using the novel operators and are solved through the generalized Lapla...

Full description

Saved in:
Bibliographic Details
Main Authors: Ahsan Mehmood, Muhammad Samraiz, Zhi-Guo Liu, Miguel Vivas-Cortez
Format: Article
Language:English
Published: Elsevier 2025-09-01
Series:Alexandria Engineering Journal
Subjects:
Online Access:http://www.sciencedirect.com/science/article/pii/S1110016825008087
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1849248159285379072
author Ahsan Mehmood
Muhammad Samraiz
Zhi-Guo Liu
Miguel Vivas-Cortez
author_facet Ahsan Mehmood
Muhammad Samraiz
Zhi-Guo Liu
Miguel Vivas-Cortez
author_sort Ahsan Mehmood
collection DOAJ
description In this paper, the extended form of the modified Atangana–Baleanu (A-B) Caputo fractional operators (FOs) is introduced and their properties and applications are demonstrated. Some fractional differential equations are formulated using the novel operators and are solved through the generalized Laplace transform. The fractional differential equations of electromagnetic waves in plasma are analyzed using the newly defined operators with applications observed in various scientific fields. The behavior of electromagnetic waves in plasma is studied for different fractional orders and parameter values and the results are presented in the form of tables as well as 2D and 3D graphs. Changes in wavelength for various domain values and fractional orders are computed based on these graphs and tables. The relationship between the newly defined operators and those existing in the literature is examined and it is concluded that the introduced operators are more generalized than the previously established ones.
format Article
id doaj-art-2a60711b315d4873aaf99add979fbe49
institution Kabale University
issn 1110-0168
language English
publishDate 2025-09-01
publisher Elsevier
record_format Article
series Alexandria Engineering Journal
spelling doaj-art-2a60711b315d4873aaf99add979fbe492025-08-20T03:58:00ZengElsevierAlexandria Engineering Journal1110-01682025-09-0112885286610.1016/j.aej.2025.06.058Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operatorsAhsan Mehmood0Muhammad Samraiz1Zhi-Guo Liu2Miguel Vivas-Cortez3School of Mathematical Sciences and Shanghai Key Laboratory PMMP, East China Normal University, 500 Dongchuan Road, Shanghai, 200241, ChinaDepartment of Mathematics, University of Sargodha, P.O. Box 40100, Sargodha, PakistanSchool of Mathematical Sciences and Shanghai Key Laboratory PMMP, East China Normal University, 500 Dongchuan Road, Shanghai, 200241, ChinaPontificia Universidad Católica del Ecuador, Facultad de Ciencias Exactas, Naturales y Ambientales, FRACTAL (Fractional Research Convexity Analysis and Their Laboratory Applications), Ecuador; Corresponding author.In this paper, the extended form of the modified Atangana–Baleanu (A-B) Caputo fractional operators (FOs) is introduced and their properties and applications are demonstrated. Some fractional differential equations are formulated using the novel operators and are solved through the generalized Laplace transform. The fractional differential equations of electromagnetic waves in plasma are analyzed using the newly defined operators with applications observed in various scientific fields. The behavior of electromagnetic waves in plasma is studied for different fractional orders and parameter values and the results are presented in the form of tables as well as 2D and 3D graphs. Changes in wavelength for various domain values and fractional orders are computed based on these graphs and tables. The relationship between the newly defined operators and those existing in the literature is examined and it is concluded that the introduced operators are more generalized than the previously established ones.http://www.sciencedirect.com/science/article/pii/S1110016825008087Fractional operatorsMittag-Leffler functionGeneralized Laplace transformFractional differential equation
spellingShingle Ahsan Mehmood
Muhammad Samraiz
Zhi-Guo Liu
Miguel Vivas-Cortez
Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators
Alexandria Engineering Journal
Fractional operators
Mittag-Leffler function
Generalized Laplace transform
Fractional differential equation
title Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators
title_full Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators
title_fullStr Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators
title_full_unstemmed Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators
title_short Uniqueness property of the generalized Laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators
title_sort uniqueness property of the generalized laplace transform and computational visualization of electromagnetic waves in plasma via fractional operators
topic Fractional operators
Mittag-Leffler function
Generalized Laplace transform
Fractional differential equation
url http://www.sciencedirect.com/science/article/pii/S1110016825008087
work_keys_str_mv AT ahsanmehmood uniquenesspropertyofthegeneralizedlaplacetransformandcomputationalvisualizationofelectromagneticwavesinplasmaviafractionaloperators
AT muhammadsamraiz uniquenesspropertyofthegeneralizedlaplacetransformandcomputationalvisualizationofelectromagneticwavesinplasmaviafractionaloperators
AT zhiguoliu uniquenesspropertyofthegeneralizedlaplacetransformandcomputationalvisualizationofelectromagneticwavesinplasmaviafractionaloperators
AT miguelvivascortez uniquenesspropertyofthegeneralizedlaplacetransformandcomputationalvisualizationofelectromagneticwavesinplasmaviafractionaloperators