Effects of physical exercise programs on cognitive function in Parkinson's disease patients: A systematic review of randomized controlled trials of the last 10 years.

<h4>Background</h4>Given the relative importance of cognitive impairment, there was considerable interest in identifying the cognitive profile of PD patients, in order to ensure specific and appropriate therapeutic interventions.<h4>Purpose</h4>To determine the effects of phy...

Full description

Saved in:
Bibliographic Details
Main Authors: Franciele Cascaes da Silva, Rodrigo da Rosa Iop, Laiana Cândido de Oliveira, Alice Mathea Boll, José Gustavo Souza de Alvarenga, Paulo José Barbosa Gutierres Filho, Lídia Mara Aguiar Bezerra de Melo, André Junqueira Xavier, Rudney da Silva
Format: Article
Language:English
Published: Public Library of Science (PLoS) 2018-01-01
Series:PLoS ONE
Online Access:https://doi.org/10.1371/journal.pone.0193113
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850169019824340992
author Franciele Cascaes da Silva
Rodrigo da Rosa Iop
Laiana Cândido de Oliveira
Alice Mathea Boll
José Gustavo Souza de Alvarenga
Paulo José Barbosa Gutierres Filho
Lídia Mara Aguiar Bezerra de Melo
André Junqueira Xavier
Rudney da Silva
author_facet Franciele Cascaes da Silva
Rodrigo da Rosa Iop
Laiana Cândido de Oliveira
Alice Mathea Boll
José Gustavo Souza de Alvarenga
Paulo José Barbosa Gutierres Filho
Lídia Mara Aguiar Bezerra de Melo
André Junqueira Xavier
Rudney da Silva
author_sort Franciele Cascaes da Silva
collection DOAJ
description <h4>Background</h4>Given the relative importance of cognitive impairment, there was considerable interest in identifying the cognitive profile of PD patients, in order to ensure specific and appropriate therapeutic interventions.<h4>Purpose</h4>To determine the effects of physical exercise programs on cognitive function in PD patients, compared with the control group.<h4>Data sources</h4>Medline, Cochrane, Scopus, PEDro and Web of Science (last searched in September 2016).<h4>Study selection</h4>Randomized clinical trials examining the effects of physical exercise programs and cognitive function in PD patients. Nine studies fulfilled the selection criteria and were included in this review.<h4>Data extraction</h4>Characteristics of the publication, characteristics of the participants, test used for cognitive screening, cognitive domain assessed, tools used to assess cognitive function, characteristics of the experimental intervention, characteristics of the control group, mean results and standard deviation of function cognitive. The PEDro score was used to evaluate methodological quality.<h4>Data synthesis</h4>Most eligible studies showed good methodological quality based on the PEDro scale. Studies have shown that adapted tango for PD patients, cognitive training combined with motor training, and treadmill training promote the preservation or improvement of cognitive function in PD patients.<h4>Limitations</h4>The diversity of cognitive tests used to assess cognitive function and the high heterogeneity identified between the physical exercise programs.<h4>Conclusions</h4>Physical exercise programs promote positive and significant effects on global cognitive function, processing speed, sustained attention and mental flexibility in PD patients, at a mild to moderate stage for patients with a 6-year clinical diagnosis of PD. However, treadmill training performed 3 times a week for about 60 minutes and for a period of 24 weeks produced larger improvements in cognition.
format Article
id doaj-art-28e347a0dfa443d58e62f8331f85dc29
institution OA Journals
issn 1932-6203
language English
publishDate 2018-01-01
publisher Public Library of Science (PLoS)
record_format Article
series PLoS ONE
spelling doaj-art-28e347a0dfa443d58e62f8331f85dc292025-08-20T02:20:51ZengPublic Library of Science (PLoS)PLoS ONE1932-62032018-01-01132e019311310.1371/journal.pone.0193113Effects of physical exercise programs on cognitive function in Parkinson's disease patients: A systematic review of randomized controlled trials of the last 10 years.Franciele Cascaes da SilvaRodrigo da Rosa IopLaiana Cândido de OliveiraAlice Mathea BollJosé Gustavo Souza de AlvarengaPaulo José Barbosa Gutierres FilhoLídia Mara Aguiar Bezerra de MeloAndré Junqueira XavierRudney da Silva<h4>Background</h4>Given the relative importance of cognitive impairment, there was considerable interest in identifying the cognitive profile of PD patients, in order to ensure specific and appropriate therapeutic interventions.<h4>Purpose</h4>To determine the effects of physical exercise programs on cognitive function in PD patients, compared with the control group.<h4>Data sources</h4>Medline, Cochrane, Scopus, PEDro and Web of Science (last searched in September 2016).<h4>Study selection</h4>Randomized clinical trials examining the effects of physical exercise programs and cognitive function in PD patients. Nine studies fulfilled the selection criteria and were included in this review.<h4>Data extraction</h4>Characteristics of the publication, characteristics of the participants, test used for cognitive screening, cognitive domain assessed, tools used to assess cognitive function, characteristics of the experimental intervention, characteristics of the control group, mean results and standard deviation of function cognitive. The PEDro score was used to evaluate methodological quality.<h4>Data synthesis</h4>Most eligible studies showed good methodological quality based on the PEDro scale. Studies have shown that adapted tango for PD patients, cognitive training combined with motor training, and treadmill training promote the preservation or improvement of cognitive function in PD patients.<h4>Limitations</h4>The diversity of cognitive tests used to assess cognitive function and the high heterogeneity identified between the physical exercise programs.<h4>Conclusions</h4>Physical exercise programs promote positive and significant effects on global cognitive function, processing speed, sustained attention and mental flexibility in PD patients, at a mild to moderate stage for patients with a 6-year clinical diagnosis of PD. However, treadmill training performed 3 times a week for about 60 minutes and for a period of 24 weeks produced larger improvements in cognition.https://doi.org/10.1371/journal.pone.0193113
spellingShingle Franciele Cascaes da Silva
Rodrigo da Rosa Iop
Laiana Cândido de Oliveira
Alice Mathea Boll
José Gustavo Souza de Alvarenga
Paulo José Barbosa Gutierres Filho
Lídia Mara Aguiar Bezerra de Melo
André Junqueira Xavier
Rudney da Silva
Effects of physical exercise programs on cognitive function in Parkinson's disease patients: A systematic review of randomized controlled trials of the last 10 years.
PLoS ONE
title Effects of physical exercise programs on cognitive function in Parkinson's disease patients: A systematic review of randomized controlled trials of the last 10 years.
title_full Effects of physical exercise programs on cognitive function in Parkinson's disease patients: A systematic review of randomized controlled trials of the last 10 years.
title_fullStr Effects of physical exercise programs on cognitive function in Parkinson's disease patients: A systematic review of randomized controlled trials of the last 10 years.
title_full_unstemmed Effects of physical exercise programs on cognitive function in Parkinson's disease patients: A systematic review of randomized controlled trials of the last 10 years.
title_short Effects of physical exercise programs on cognitive function in Parkinson's disease patients: A systematic review of randomized controlled trials of the last 10 years.
title_sort effects of physical exercise programs on cognitive function in parkinson s disease patients a systematic review of randomized controlled trials of the last 10 years
url https://doi.org/10.1371/journal.pone.0193113
work_keys_str_mv AT francielecascaesdasilva effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT rodrigodarosaiop effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT laianacandidodeoliveira effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT alicematheaboll effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT josegustavosouzadealvarenga effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT paulojosebarbosagutierresfilho effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT lidiamaraaguiarbezerrademelo effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT andrejunqueiraxavier effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT rudneydasilva effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years