Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data

We present a review and primer of methods to understand epidemiological dynamics and identify past exposures from serological data, referred to as serodynamics. We discuss processing and interpreting serological data prior to fitting serodynamical models, and review approaches for estimating epidemi...

Full description

Saved in:
Bibliographic Details
Main Authors: James A. Hay, Isobel Routledge, Saki Takahashi
Format: Article
Language:English
Published: Elsevier 2024-12-01
Series:Epidemics
Subjects:
Online Access:http://www.sciencedirect.com/science/article/pii/S1755436524000677
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1850065024597360640
author James A. Hay
Isobel Routledge
Saki Takahashi
author_facet James A. Hay
Isobel Routledge
Saki Takahashi
author_sort James A. Hay
collection DOAJ
description We present a review and primer of methods to understand epidemiological dynamics and identify past exposures from serological data, referred to as serodynamics. We discuss processing and interpreting serological data prior to fitting serodynamical models, and review approaches for estimating epidemiological trends and past exposures, ranging from serocatalytic models applied to binary serostatus data, to more complex models incorporating quantitative antibody measurements and immunological understanding. Although these methods are seemingly disparate, we demonstrate how they are derived within a common mathematical framework. Finally, we discuss key areas for methodological development to improve scientific discovery and public health insights in seroepidemiology.
format Article
id doaj-art-1a349726c5fa413aa29336b201dacb97
institution DOAJ
issn 1755-4365
language English
publishDate 2024-12-01
publisher Elsevier
record_format Article
series Epidemics
spelling doaj-art-1a349726c5fa413aa29336b201dacb972025-08-20T02:49:06ZengElsevierEpidemics1755-43652024-12-014910080610.1016/j.epidem.2024.100806Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological dataJames A. Hay0Isobel Routledge1Saki Takahashi2Pandemic Sciences Institute, Nuffield Department of Medicine, University of Oxford, Oxford, United Kingdom; Corresponding authors.Department of Medicine, University of California San Francisco, San Francisco, CA, USA; Corresponding authors.Department of Epidemiology, Johns Hopkins Bloomberg School of Public Health, Baltimore, MD, USA; Corresponding authors.We present a review and primer of methods to understand epidemiological dynamics and identify past exposures from serological data, referred to as serodynamics. We discuss processing and interpreting serological data prior to fitting serodynamical models, and review approaches for estimating epidemiological trends and past exposures, ranging from serocatalytic models applied to binary serostatus data, to more complex models incorporating quantitative antibody measurements and immunological understanding. Although these methods are seemingly disparate, we demonstrate how they are derived within a common mathematical framework. Finally, we discuss key areas for methodological development to improve scientific discovery and public health insights in seroepidemiology.http://www.sciencedirect.com/science/article/pii/S1755436524000677SerologySeroepidemiologySerodynamicsInfectious disease modeling
spellingShingle James A. Hay
Isobel Routledge
Saki Takahashi
Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data
Epidemics
Serology
Seroepidemiology
Serodynamics
Infectious disease modeling
title Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data
title_full Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data
title_fullStr Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data
title_full_unstemmed Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data
title_short Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data
title_sort serodynamics a primer and synthetic review of methods for epidemiological inference using serological data
topic Serology
Seroepidemiology
Serodynamics
Infectious disease modeling
url http://www.sciencedirect.com/science/article/pii/S1755436524000677
work_keys_str_mv AT jamesahay serodynamicsaprimerandsyntheticreviewofmethodsforepidemiologicalinferenceusingserologicaldata
AT isobelroutledge serodynamicsaprimerandsyntheticreviewofmethodsforepidemiologicalinferenceusingserologicaldata
AT sakitakahashi serodynamicsaprimerandsyntheticreviewofmethodsforepidemiologicalinferenceusingserologicaldata