Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data
We present a review and primer of methods to understand epidemiological dynamics and identify past exposures from serological data, referred to as serodynamics. We discuss processing and interpreting serological data prior to fitting serodynamical models, and review approaches for estimating epidemi...
Saved in:
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Elsevier
2024-12-01
|
| Series: | Epidemics |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S1755436524000677 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850065024597360640 |
|---|---|
| author | James A. Hay Isobel Routledge Saki Takahashi |
| author_facet | James A. Hay Isobel Routledge Saki Takahashi |
| author_sort | James A. Hay |
| collection | DOAJ |
| description | We present a review and primer of methods to understand epidemiological dynamics and identify past exposures from serological data, referred to as serodynamics. We discuss processing and interpreting serological data prior to fitting serodynamical models, and review approaches for estimating epidemiological trends and past exposures, ranging from serocatalytic models applied to binary serostatus data, to more complex models incorporating quantitative antibody measurements and immunological understanding. Although these methods are seemingly disparate, we demonstrate how they are derived within a common mathematical framework. Finally, we discuss key areas for methodological development to improve scientific discovery and public health insights in seroepidemiology. |
| format | Article |
| id | doaj-art-1a349726c5fa413aa29336b201dacb97 |
| institution | DOAJ |
| issn | 1755-4365 |
| language | English |
| publishDate | 2024-12-01 |
| publisher | Elsevier |
| record_format | Article |
| series | Epidemics |
| spelling | doaj-art-1a349726c5fa413aa29336b201dacb972025-08-20T02:49:06ZengElsevierEpidemics1755-43652024-12-014910080610.1016/j.epidem.2024.100806Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological dataJames A. Hay0Isobel Routledge1Saki Takahashi2Pandemic Sciences Institute, Nuffield Department of Medicine, University of Oxford, Oxford, United Kingdom; Corresponding authors.Department of Medicine, University of California San Francisco, San Francisco, CA, USA; Corresponding authors.Department of Epidemiology, Johns Hopkins Bloomberg School of Public Health, Baltimore, MD, USA; Corresponding authors.We present a review and primer of methods to understand epidemiological dynamics and identify past exposures from serological data, referred to as serodynamics. We discuss processing and interpreting serological data prior to fitting serodynamical models, and review approaches for estimating epidemiological trends and past exposures, ranging from serocatalytic models applied to binary serostatus data, to more complex models incorporating quantitative antibody measurements and immunological understanding. Although these methods are seemingly disparate, we demonstrate how they are derived within a common mathematical framework. Finally, we discuss key areas for methodological development to improve scientific discovery and public health insights in seroepidemiology.http://www.sciencedirect.com/science/article/pii/S1755436524000677SerologySeroepidemiologySerodynamicsInfectious disease modeling |
| spellingShingle | James A. Hay Isobel Routledge Saki Takahashi Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data Epidemics Serology Seroepidemiology Serodynamics Infectious disease modeling |
| title | Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data |
| title_full | Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data |
| title_fullStr | Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data |
| title_full_unstemmed | Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data |
| title_short | Serodynamics: A primer and synthetic review of methods for epidemiological inference using serological data |
| title_sort | serodynamics a primer and synthetic review of methods for epidemiological inference using serological data |
| topic | Serology Seroepidemiology Serodynamics Infectious disease modeling |
| url | http://www.sciencedirect.com/science/article/pii/S1755436524000677 |
| work_keys_str_mv | AT jamesahay serodynamicsaprimerandsyntheticreviewofmethodsforepidemiologicalinferenceusingserologicaldata AT isobelroutledge serodynamicsaprimerandsyntheticreviewofmethodsforepidemiologicalinferenceusingserologicaldata AT sakitakahashi serodynamicsaprimerandsyntheticreviewofmethodsforepidemiologicalinferenceusingserologicaldata |