Correlation between dyslipidemia and disease activity of lupus nephritis
Objective To explore the correlation between dyslipidemia and lupus nephritis（LN）.Methods From January 2016 to January 2019,472 LN patients were retrospectively analyzed.And 212 of them received renal biopsy and 236 healthy people were selected according to a ratio of 2:1.Based upon lupus activity s...
Saved in:
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | zho |
| Published: |
Editorial Department of Journal of Clinical Nephrology
2021-01-01
|
| Series: | Linchuang shenzangbing zazhi |
| Subjects: | |
| Online Access: | http://www.lcszb.com/thesisDetails?columnId=57903845&Fpath=home&index=0 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1849729441883750400 |
|---|---|
| author | Hu Hong-tu Ding Guo-hua Chen Xing-hua |
| author_facet | Hu Hong-tu Ding Guo-hua Chen Xing-hua |
| author_sort | Hu Hong-tu |
| collection | DOAJ |
| description | Objective To explore the correlation between dyslipidemia and lupus nephritis（LN）.Methods From January 2016 to January 2019,472 LN patients were retrospectively analyzed.And 212 of them received renal biopsy and 236 healthy people were selected according to a ratio of 2:1.Based upon lupus activity score（SLEDAI）,pathological type of LN and blood levels of total cholesterol（TC）,total triglyceride（TG）,high density lipoprotein cholesterol（HDL-C）and low density lipoprotein cholesterol（LDL-C）were recorded.Analysis of variance and correlation were utilized for examining the correlation between dyslipidemia and disease activity of LN.Results The average levels of blood lipids（TC/TG/HDL-C/LDL-C）in LN patients were higher than those in healthy subjects and the differences in the levels of TC,TG and HDL-C were statistically significant（P<0.01）;The levels of TC,TG,LDL-C,SLEDAI and 24-hour LDL-C were higher in LN dyslipidemia group.The incidence rate of total protein 24 hUTP,urea nitrogen（BUN）,uric acid（UA）,D-dimmer and erythrocyte sedimentation rate（ESR）in urine were higher than those in normal lipid group.Estimated glomerular filtration rate（eGFR）,LDL-C and albumin（Alb）were lower than those of normal lipid group（P<0.05）.Significant differences existed in TC（F=4.839,P=0.008）,TG（F=3.105,P=0.046）and LDL-C（F=4.605,P=0.046）among different SLEDAI groups.The levels of TC,TG and LDL-C were significantly higher in severe active group than those in control group（P<0.05）.Logistic regression analysis showed that the elevation of TC/TG and the reduction of HDL-C were the risk factors of LN.Pearson’s correlation analysis indicated that the levels of TC,TG and LDL-C were positively correlated with SLEDAI（r>0,P>0.05）while the level of HDL-C negatively correlated with SLEDAI（r<0,P<0.05）.Conclusion A significant correlation exists between blood lipid level and SLEDAI in LN patients.Early monitoring of blood lipid level is of great significance for tracking the disease activity of LN patients. |
| format | Article |
| id | doaj-art-0e1ac100c5254234b66cb89613428e4e |
| institution | DOAJ |
| issn | 1671-2390 |
| language | zho |
| publishDate | 2021-01-01 |
| publisher | Editorial Department of Journal of Clinical Nephrology |
| record_format | Article |
| series | Linchuang shenzangbing zazhi |
| spelling | doaj-art-0e1ac100c5254234b66cb89613428e4e2025-08-20T03:09:13ZzhoEditorial Department of Journal of Clinical NephrologyLinchuang shenzangbing zazhi1671-23902021-01-012144144657903845Correlation between dyslipidemia and disease activity of lupus nephritisHu Hong-tuDing Guo-huaChen Xing-huaObjective To explore the correlation between dyslipidemia and lupus nephritis（LN）.Methods From January 2016 to January 2019,472 LN patients were retrospectively analyzed.And 212 of them received renal biopsy and 236 healthy people were selected according to a ratio of 2:1.Based upon lupus activity score（SLEDAI）,pathological type of LN and blood levels of total cholesterol（TC）,total triglyceride（TG）,high density lipoprotein cholesterol（HDL-C）and low density lipoprotein cholesterol（LDL-C）were recorded.Analysis of variance and correlation were utilized for examining the correlation between dyslipidemia and disease activity of LN.Results The average levels of blood lipids（TC/TG/HDL-C/LDL-C）in LN patients were higher than those in healthy subjects and the differences in the levels of TC,TG and HDL-C were statistically significant（P<0.01）;The levels of TC,TG,LDL-C,SLEDAI and 24-hour LDL-C were higher in LN dyslipidemia group.The incidence rate of total protein 24 hUTP,urea nitrogen（BUN）,uric acid（UA）,D-dimmer and erythrocyte sedimentation rate（ESR）in urine were higher than those in normal lipid group.Estimated glomerular filtration rate（eGFR）,LDL-C and albumin（Alb）were lower than those of normal lipid group（P<0.05）.Significant differences existed in TC（F=4.839,P=0.008）,TG（F=3.105,P=0.046）and LDL-C（F=4.605,P=0.046）among different SLEDAI groups.The levels of TC,TG and LDL-C were significantly higher in severe active group than those in control group（P<0.05）.Logistic regression analysis showed that the elevation of TC/TG and the reduction of HDL-C were the risk factors of LN.Pearson’s correlation analysis indicated that the levels of TC,TG and LDL-C were positively correlated with SLEDAI（r>0,P>0.05）while the level of HDL-C negatively correlated with SLEDAI（r<0,P<0.05）.Conclusion A significant correlation exists between blood lipid level and SLEDAI in LN patients.Early monitoring of blood lipid level is of great significance for tracking the disease activity of LN patients.http://www.lcszb.com/thesisDetails?columnId=57903845&Fpath=home&index=0Lupus nephritisDyslipidemiasLupus activity |
| spellingShingle | Hu Hong-tu Ding Guo-hua Chen Xing-hua Correlation between dyslipidemia and disease activity of lupus nephritis Linchuang shenzangbing zazhi Lupus nephritis Dyslipidemias Lupus activity |
| title | Correlation between dyslipidemia and disease activity of lupus nephritis |
| title_full | Correlation between dyslipidemia and disease activity of lupus nephritis |
| title_fullStr | Correlation between dyslipidemia and disease activity of lupus nephritis |
| title_full_unstemmed | Correlation between dyslipidemia and disease activity of lupus nephritis |
| title_short | Correlation between dyslipidemia and disease activity of lupus nephritis |
| title_sort | correlation between dyslipidemia and disease activity of lupus nephritis |
| topic | Lupus nephritis Dyslipidemias Lupus activity |
| url | http://www.lcszb.com/thesisDetails?columnId=57903845&Fpath=home&index=0 |
| work_keys_str_mv | AT huhongtu correlationbetweendyslipidemiaanddiseaseactivityoflupusnephritis AT dingguohua correlationbetweendyslipidemiaanddiseaseactivityoflupusnephritis AT chenxinghua correlationbetweendyslipidemiaanddiseaseactivityoflupusnephritis |