Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids

Sulphonamide and 1,3,4-oxadiazole moieties are present as integral structural parts of many drugs and pharmaceuticals. Taking into account the significance of these moieties, we herein present the synthesis, single-crystal X-ray analysis, DFT studies, and α-amylase inhibition of probenecid derived t...

Full description

Saved in:
Bibliographic Details
Main Authors: Bilal Ahmad Khan, Syeda Shamila Hamdani, Muhammad Naeem Ahmed, Shahid Hameed, Muhammad Ashfaq, Ahmed M. Shawky, Mahmoud A. A. Ibrahim, Peter A. Sidhom
Format: Article
Language:English
Published: Taylor & Francis Group 2022-12-01
Series:Journal of Enzyme Inhibition and Medicinal Chemistry
Subjects:
Online Access:https://www.tandfonline.com/doi/10.1080/14756366.2022.2078969
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1849687714611331072
author Bilal Ahmad Khan
Syeda Shamila Hamdani
Muhammad Naeem Ahmed
Shahid Hameed
Muhammad Ashfaq
Ahmed M. Shawky
Mahmoud A. A. Ibrahim
Peter A. Sidhom
author_facet Bilal Ahmad Khan
Syeda Shamila Hamdani
Muhammad Naeem Ahmed
Shahid Hameed
Muhammad Ashfaq
Ahmed M. Shawky
Mahmoud A. A. Ibrahim
Peter A. Sidhom
author_sort Bilal Ahmad Khan
collection DOAJ
description Sulphonamide and 1,3,4-oxadiazole moieties are present as integral structural parts of many drugs and pharmaceuticals. Taking into account the significance of these moieties, we herein present the synthesis, single-crystal X-ray analysis, DFT studies, and α-amylase inhibition of probenecid derived two S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids. The synthesis has been accomplished in high yields. The final structures of both hybrids have been established completely with the help of different spectro-analytical techniques, including NMR, FTIR, HR-MS, and single-crystal X-ray diffraction analyses. In an effort to confirm the experimental findings, versatile quantum mechanical calculations and Hirshfeld Surface analysis have been performed. α-Amylase inhibition assay has been executed to investigate the enzyme inhibitory potential of both hybrids. The low IC50 value (76.92 ± 0.19 μg/mL) of hybrid 2 shows the good α-amylase inhibition potential of the respective compound. Ultimately, the binding affinities and features of the two hybrids are elucidated utilising a molecular docking technique against the α-amylase enzyme.
format Article
id doaj-art-0c30a4906dfd440bae3f0be210e1fa42
institution DOAJ
issn 1475-6366
1475-6374
language English
publishDate 2022-12-01
publisher Taylor & Francis Group
record_format Article
series Journal of Enzyme Inhibition and Medicinal Chemistry
spelling doaj-art-0c30a4906dfd440bae3f0be210e1fa422025-08-20T03:22:15ZengTaylor & Francis GroupJournal of Enzyme Inhibition and Medicinal Chemistry1475-63661475-63742022-12-013711464147810.1080/14756366.2022.2078969Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybridsBilal Ahmad Khan0Syeda Shamila Hamdani1Muhammad Naeem Ahmed2Shahid Hameed3Muhammad Ashfaq4Ahmed M. Shawky5Mahmoud A. A. Ibrahim6Peter A. Sidhom7Department of Chemistry, The University of Azad Jammu and Kashmir, Muzaffarabad, PakistanDepartment of Chemistry, The University of Azad Jammu and Kashmir, Muzaffarabad, PakistanDepartment of Chemistry, The University of Azad Jammu and Kashmir, Muzaffarabad, PakistanDepartment of Chemistry, Quaid-i-Azam University, Islamabad, PakistanDepartment of Physics, University of Sargodha, Sargodha, PakistanScience and Technology Unit (STU), Umm Al-Qura University, Makkah, Saudi ArabiaComputational Chemistry Laboratory, Chemistry Department, Faculty of Science, Minia University, Minia, EgyptDepartment of Pharmaceutical Chemistry, Faculty of Pharmacy, Tanta University, Tanta, EgyptSulphonamide and 1,3,4-oxadiazole moieties are present as integral structural parts of many drugs and pharmaceuticals. Taking into account the significance of these moieties, we herein present the synthesis, single-crystal X-ray analysis, DFT studies, and α-amylase inhibition of probenecid derived two S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids. The synthesis has been accomplished in high yields. The final structures of both hybrids have been established completely with the help of different spectro-analytical techniques, including NMR, FTIR, HR-MS, and single-crystal X-ray diffraction analyses. In an effort to confirm the experimental findings, versatile quantum mechanical calculations and Hirshfeld Surface analysis have been performed. α-Amylase inhibition assay has been executed to investigate the enzyme inhibitory potential of both hybrids. The low IC50 value (76.92 ± 0.19 μg/mL) of hybrid 2 shows the good α-amylase inhibition potential of the respective compound. Ultimately, the binding affinities and features of the two hybrids are elucidated utilising a molecular docking technique against the α-amylase enzyme.https://www.tandfonline.com/doi/10.1080/14756366.2022.2078969OxadiazoleprobenecidX-ray diffractionenzyme inhibitionmolecular modelling
spellingShingle Bilal Ahmad Khan
Syeda Shamila Hamdani
Muhammad Naeem Ahmed
Shahid Hameed
Muhammad Ashfaq
Ahmed M. Shawky
Mahmoud A. A. Ibrahim
Peter A. Sidhom
Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids
Journal of Enzyme Inhibition and Medicinal Chemistry
Oxadiazole
probenecid
X-ray diffraction
enzyme inhibition
molecular modelling
title Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids
title_full Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids
title_fullStr Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids
title_full_unstemmed Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids
title_short Synthesis, X-ray diffraction analysis, quantum chemical studies and α-amylase inhibition of probenecid derived S-alkylphthalimide-oxadiazole-benzenesulfonamide hybrids
title_sort synthesis x ray diffraction analysis quantum chemical studies and α amylase inhibition of probenecid derived s alkylphthalimide oxadiazole benzenesulfonamide hybrids
topic Oxadiazole
probenecid
X-ray diffraction
enzyme inhibition
molecular modelling
url https://www.tandfonline.com/doi/10.1080/14756366.2022.2078969
work_keys_str_mv AT bilalahmadkhan synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids
AT syedashamilahamdani synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids
AT muhammadnaeemahmed synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids
AT shahidhameed synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids
AT muhammadashfaq synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids
AT ahmedmshawky synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids
AT mahmoudaaibrahim synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids
AT peterasidhom synthesisxraydiffractionanalysisquantumchemicalstudiesandaamylaseinhibitionofprobenecidderivedsalkylphthalimideoxadiazolebenzenesulfonamidehybrids