Effects of ethnic attributes on the quality of family planning services in Lima, Peru: a randomized crossover trial.
Most studies reporting ethnic disparities in the quality of healthcare come from developed countries and rely on observational methods. We conducted the first experimental study to evaluate whether health providers in Peru provide differential quality of care for family planning services, based on t...
Saved in:
| Main Authors: | , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Public Library of Science (PLoS)
2015-01-01
|
| Series: | PLoS ONE |
| Online Access: | https://journals.plos.org/plosone/article/file?id=10.1371/journal.pone.0115274&type=printable |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850281354724376576 |
|---|---|
| author | Maria-Elena Planas Patricia J García Monserrat Bustelo Cesar P Carcamo Sebastian Martinez Hugo Nopo Julio Rodriguez Maria-Fernanda Merino Andrew Morrison |
| author_facet | Maria-Elena Planas Patricia J García Monserrat Bustelo Cesar P Carcamo Sebastian Martinez Hugo Nopo Julio Rodriguez Maria-Fernanda Merino Andrew Morrison |
| author_sort | Maria-Elena Planas |
| collection | DOAJ |
| description | Most studies reporting ethnic disparities in the quality of healthcare come from developed countries and rely on observational methods. We conducted the first experimental study to evaluate whether health providers in Peru provide differential quality of care for family planning services, based on the indigenous or mestizo (mixed ethnoracial ancestry) profile of the patient. In a crossover randomized controlled trial conducted in 2012, a sample of 351 out of the 408 public health establishments in Metropolitan Lima, Peru were randomly assigned to receive unannounced simulated patients enacting indigenous and mestizo profiles (sequence-1) or mestizo and then indigenous profiles (sequence-2), with a five week wash-out period. Both ethnic profiles used the same scripted scenario for seeking contraceptive advice but had distinctive cultural attributes such as clothing, styling of hair, make-up, accessories, posture and patterns of movement and speech. Our primary outcome measure of quality of care is the proportion of technical tasks performed by providers, as established by Peruvian family planning clinical guidelines. Providers and data analysts were kept blinded to the allocation. We found a non-significant mean difference of -0.7% (p = 0.23) between ethnic profiles in the percentage of technical tasks performed by providers. However we report large deficiencies in the compliance with quality standards of care for both profiles. Differential provider behaviour based on the patient's ethnic profiles compared in the study did not contribute to deficiencies in family planning outcomes observed. The study highlights the need to explore other determinants for poor compliance with quality standards, including demand and supply side factors, and calls for interventions to improve the quality of care for family planning services in Metropolitan Lima. |
| format | Article |
| id | doaj-art-0a3479a862ea458ea30b102d6e517775 |
| institution | OA Journals |
| issn | 1932-6203 |
| language | English |
| publishDate | 2015-01-01 |
| publisher | Public Library of Science (PLoS) |
| record_format | Article |
| series | PLoS ONE |
| spelling | doaj-art-0a3479a862ea458ea30b102d6e5177752025-08-20T01:48:21ZengPublic Library of Science (PLoS)PLoS ONE1932-62032015-01-01102e011527410.1371/journal.pone.0115274Effects of ethnic attributes on the quality of family planning services in Lima, Peru: a randomized crossover trial.Maria-Elena PlanasPatricia J GarcíaMonserrat BusteloCesar P CarcamoSebastian MartinezHugo NopoJulio RodriguezMaria-Fernanda MerinoAndrew MorrisonMost studies reporting ethnic disparities in the quality of healthcare come from developed countries and rely on observational methods. We conducted the first experimental study to evaluate whether health providers in Peru provide differential quality of care for family planning services, based on the indigenous or mestizo (mixed ethnoracial ancestry) profile of the patient. In a crossover randomized controlled trial conducted in 2012, a sample of 351 out of the 408 public health establishments in Metropolitan Lima, Peru were randomly assigned to receive unannounced simulated patients enacting indigenous and mestizo profiles (sequence-1) or mestizo and then indigenous profiles (sequence-2), with a five week wash-out period. Both ethnic profiles used the same scripted scenario for seeking contraceptive advice but had distinctive cultural attributes such as clothing, styling of hair, make-up, accessories, posture and patterns of movement and speech. Our primary outcome measure of quality of care is the proportion of technical tasks performed by providers, as established by Peruvian family planning clinical guidelines. Providers and data analysts were kept blinded to the allocation. We found a non-significant mean difference of -0.7% (p = 0.23) between ethnic profiles in the percentage of technical tasks performed by providers. However we report large deficiencies in the compliance with quality standards of care for both profiles. Differential provider behaviour based on the patient's ethnic profiles compared in the study did not contribute to deficiencies in family planning outcomes observed. The study highlights the need to explore other determinants for poor compliance with quality standards, including demand and supply side factors, and calls for interventions to improve the quality of care for family planning services in Metropolitan Lima.https://journals.plos.org/plosone/article/file?id=10.1371/journal.pone.0115274&type=printable |
| spellingShingle | Maria-Elena Planas Patricia J García Monserrat Bustelo Cesar P Carcamo Sebastian Martinez Hugo Nopo Julio Rodriguez Maria-Fernanda Merino Andrew Morrison Effects of ethnic attributes on the quality of family planning services in Lima, Peru: a randomized crossover trial. PLoS ONE |
| title | Effects of ethnic attributes on the quality of family planning services in Lima, Peru: a randomized crossover trial. |
| title_full | Effects of ethnic attributes on the quality of family planning services in Lima, Peru: a randomized crossover trial. |
| title_fullStr | Effects of ethnic attributes on the quality of family planning services in Lima, Peru: a randomized crossover trial. |
| title_full_unstemmed | Effects of ethnic attributes on the quality of family planning services in Lima, Peru: a randomized crossover trial. |
| title_short | Effects of ethnic attributes on the quality of family planning services in Lima, Peru: a randomized crossover trial. |
| title_sort | effects of ethnic attributes on the quality of family planning services in lima peru a randomized crossover trial |
| url | https://journals.plos.org/plosone/article/file?id=10.1371/journal.pone.0115274&type=printable |
| work_keys_str_mv | AT mariaelenaplanas effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial AT patriciajgarcia effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial AT monserratbustelo effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial AT cesarpcarcamo effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial AT sebastianmartinez effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial AT hugonopo effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial AT juliorodriguez effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial AT mariafernandamerino effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial AT andrewmorrison effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial |