The Evolution and Determinants of Interorganizational Coinvention Networks in New Energy Vehicles: Evidence from Shenzhen, China
With the increasing attention to climate change, air pollution, and related public health issues, China’s new energy vehicles (NEVs) industry has developed rapidly. However, few studies investigated the evolution of interorganizational collaborative innovation networks in the sector domain of NEVs a...
Saved in:
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2021-01-01
|
| Series: | Complexity |
| Online Access: | http://dx.doi.org/10.1155/2021/6665945 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832550533918883840 |
|---|---|
| author | Jia Liu Zhaohui Chong Shijian Lu |
| author_facet | Jia Liu Zhaohui Chong Shijian Lu |
| author_sort | Jia Liu |
| collection | DOAJ |
| description | With the increasing attention to climate change, air pollution, and related public health issues, China’s new energy vehicles (NEVs) industry has developed rapidly. However, few studies investigated the evolution of interorganizational collaborative innovation networks in the sector domain of NEVs and the influence of different drivers on the establishment of innovation relationships. In this context, this paper uses the joint invention patent of Shenzhen, a low-carbon pilot city of China, to investigate the dynamics of network influencing factors. The social network analysis shows that the scale of coinvention network of NEVs is constantly increasing, which is featured with diversified cooperative entities, and collaboration depth (i.e., the intensity of the interactions with these partners) is also expanding. The empirical results from the Exponential Random Graph Model (ERGM) demonstrate that, with the deepening of collaborative innovation, technological upgrading caused by knowledge exchange makes organizations in the network more inclined to cognitive proximity and less dependent on geographical proximity. In addition, organizational proximity and triadic closure contribute positively to the collaborative network, with their relevance remaining nearly the same, while the impeding effect of cultural/language difference is slightly decreasing with time. |
| format | Article |
| id | doaj-art-0970a62914c146cdbb77eac60de975be |
| institution | Kabale University |
| issn | 1076-2787 1099-0526 |
| language | English |
| publishDate | 2021-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | Complexity |
| spelling | doaj-art-0970a62914c146cdbb77eac60de975be2025-02-03T06:06:31ZengWileyComplexity1076-27871099-05262021-01-01202110.1155/2021/66659456665945The Evolution and Determinants of Interorganizational Coinvention Networks in New Energy Vehicles: Evidence from Shenzhen, ChinaJia Liu0Zhaohui Chong1Shijian Lu2School of Economics, Guangdong University of Finance and Economics, Guangzhou 510320, ChinaBusiness School, Shantou University, Shantou 515063, ChinaSchool of Chemistry and Chemical Engineering, Liaocheng University, Liaocheng 252000, ChinaWith the increasing attention to climate change, air pollution, and related public health issues, China’s new energy vehicles (NEVs) industry has developed rapidly. However, few studies investigated the evolution of interorganizational collaborative innovation networks in the sector domain of NEVs and the influence of different drivers on the establishment of innovation relationships. In this context, this paper uses the joint invention patent of Shenzhen, a low-carbon pilot city of China, to investigate the dynamics of network influencing factors. The social network analysis shows that the scale of coinvention network of NEVs is constantly increasing, which is featured with diversified cooperative entities, and collaboration depth (i.e., the intensity of the interactions with these partners) is also expanding. The empirical results from the Exponential Random Graph Model (ERGM) demonstrate that, with the deepening of collaborative innovation, technological upgrading caused by knowledge exchange makes organizations in the network more inclined to cognitive proximity and less dependent on geographical proximity. In addition, organizational proximity and triadic closure contribute positively to the collaborative network, with their relevance remaining nearly the same, while the impeding effect of cultural/language difference is slightly decreasing with time.http://dx.doi.org/10.1155/2021/6665945 |
| spellingShingle | Jia Liu Zhaohui Chong Shijian Lu The Evolution and Determinants of Interorganizational Coinvention Networks in New Energy Vehicles: Evidence from Shenzhen, China Complexity |
| title | The Evolution and Determinants of Interorganizational Coinvention Networks in New Energy Vehicles: Evidence from Shenzhen, China |
| title_full | The Evolution and Determinants of Interorganizational Coinvention Networks in New Energy Vehicles: Evidence from Shenzhen, China |
| title_fullStr | The Evolution and Determinants of Interorganizational Coinvention Networks in New Energy Vehicles: Evidence from Shenzhen, China |
| title_full_unstemmed | The Evolution and Determinants of Interorganizational Coinvention Networks in New Energy Vehicles: Evidence from Shenzhen, China |
| title_short | The Evolution and Determinants of Interorganizational Coinvention Networks in New Energy Vehicles: Evidence from Shenzhen, China |
| title_sort | evolution and determinants of interorganizational coinvention networks in new energy vehicles evidence from shenzhen china |
| url | http://dx.doi.org/10.1155/2021/6665945 |
| work_keys_str_mv | AT jialiu theevolutionanddeterminantsofinterorganizationalcoinventionnetworksinnewenergyvehiclesevidencefromshenzhenchina AT zhaohuichong theevolutionanddeterminantsofinterorganizationalcoinventionnetworksinnewenergyvehiclesevidencefromshenzhenchina AT shijianlu theevolutionanddeterminantsofinterorganizationalcoinventionnetworksinnewenergyvehiclesevidencefromshenzhenchina AT jialiu evolutionanddeterminantsofinterorganizationalcoinventionnetworksinnewenergyvehiclesevidencefromshenzhenchina AT zhaohuichong evolutionanddeterminantsofinterorganizationalcoinventionnetworksinnewenergyvehiclesevidencefromshenzhenchina AT shijianlu evolutionanddeterminantsofinterorganizationalcoinventionnetworksinnewenergyvehiclesevidencefromshenzhenchina |